SecReT6
Immunity Protein ID: 29141003
SecReT6 ID45
T6SS typeA3
Gene symbol-
Locus tagt0488
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T6SS(s) in this replicon]
Location [Strand]561892..562410 [-]
Productlipoprotein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 3.90E-40, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|29141003|ref|NP_804345.1| lipoprotein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFMNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRD
ADKDYEQPIYDAGAITQAEAWSAKVAPEYEKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|29140543|ref|NC_004631.1|:c562410-561892 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCATGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTAGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGCTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGATAAGGATTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCAA
AAGTCGCGCCGGAATATGAGAAGCATTAA