SecReT6
Immunity Protein ID: 360035313
SecReT6 ID513
T6SS typeA1
Gene symbol-
Locus tagVch1786_I0918
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016445] [Browse all T6SS(s) in this replicon]
Location [Strand]993528..994271 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVC1419
DescriptionTsiV1
UniProt IDG7TR75
KEGG IDvce:Vch1786_I0918
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 247 a.a.     [Download]
>gi|360035313|ref|YP_004937076.1| hypothetical protein Vch1786_I0918 [Vibrio cholerae O1 str. 2010EL-1786]
MKLLNNLAIKKLISVVVLFIALFFLGYDYYQTSQPNIWGDEPDESYITISGKKPIDAYLEVWTHFWVTGD
ECEAYSYDLFGQKAHQGGKISQKITHDFAKDGSNFEFRIPYQTYKNSQNCIVELRDFSIQAHNDFDTVGF
AQLRFSPAGREYYNREVDLNSLITADNCNSDIFKSIRKEWAGAIGCHFYVDGKKKTKDEEFNAYTIYYDF
SKFNNDTVIHYDILAGENYRSEPLSSAQKTAVVSDDN
-
Nucleotide Sequence: 744 bp     [Download]
>gi|360034408|ref|NC_016445.1|:993528-994271 Vibrio cholerae O1 str. 2010EL-1786 chromosome 1, complete sequence
ATGAAGTTATTGAATAATCTTGCAATAAAAAAGCTAATCTCAGTTGTTGTACTATTCATTGCATTATTTT
TTCTTGGGTATGACTATTACCAGACTTCTCAACCTAATATTTGGGGTGATGAACCTGATGAGTCCTATAT
TACTATATCAGGCAAAAAGCCTATAGATGCTTATTTAGAAGTGTGGACTCATTTTTGGGTGACAGGAGAT
GAGTGTGAAGCTTATTCCTACGATTTATTTGGTCAAAAAGCCCATCAAGGAGGAAAAATAAGCCAGAAGA
TTACGCATGATTTTGCTAAAGATGGTTCAAATTTTGAATTTAGAATTCCTTACCAAACGTATAAGAACTC
ACAAAATTGTATAGTGGAATTAAGAGACTTTTCCATACAAGCTCATAATGATTTTGATACCGTAGGTTTT
GCTCAGTTGCGATTTTCTCCAGCAGGCAGAGAATATTACAATCGAGAGGTTGATCTAAACTCATTGATTA
CAGCAGATAATTGCAATAGTGATATATTTAAAAGTATAAGAAAAGAGTGGGCAGGAGCCATTGGTTGTCA
TTTTTATGTCGATGGAAAGAAAAAGACTAAAGATGAAGAATTCAACGCTTACACCATCTACTACGATTTT
TCGAAATTCAATAATGACACCGTGATTCATTACGATATTTTAGCCGGTGAAAACTATCGGTCAGAGCCTT
TGTCCTCAGCTCAAAAGACAGCAGTGGTATCTGATGATAATTAA