SecReT6
Immunity Protein ID: 360037246
SecReT6 ID513
T6SS typeA1
Gene symbol-
Locus tagVch1786_II0032
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]32318..32668 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVCA0286
DescriptionTsiH
UniProt IDG7TWC4
KEGG IDvce:Vch1786_II0032
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|360037246|ref|YP_004939008.1| hypothetical protein Vch1786_II0032 [Vibrio cholerae O1 str. 2010EL-1786]
MKKIIKWFAILLVSTCLAVVLLATFLFKFEYSVPNAQIIGQMIWFPEPTATGLSIVENKHPIYTIRITCG
SPDNICHEGLFEYKGNTLSKIEIRDFASYLGEEITLTNGETLEPMN
-
Nucleotide Sequence: 351 bp     [Download]
>gi|360037214|ref|NC_016446.1|:32318-32668 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGAAAAAAATCATAAAGTGGTTTGCAATCTTACTGGTATCAACCTGTCTTGCCGTAGTGCTCTTGGCTA
CGTTTCTTTTTAAATTTGAATATTCGGTACCAAATGCTCAGATTATTGGACAAATGATTTGGTTCCCAGA
GCCCACAGCAACGGGTCTCAGTATTGTAGAGAATAAACATCCTATCTATACGATTCGTATAACGTGTGGC
TCTCCGGATAATATTTGCCATGAAGGCCTATTTGAGTACAAAGGGAACACACTAAGCAAAATTGAGATAA
GAGATTTTGCTAGCTATTTAGGTGAAGAAATCACCTTAACGAATGGTGAAACCTTAGAACCTATGAATTG
A