SecReT6
Immunity Protein ID: 360038027
SecReT6 ID513
T6SS typeA1
Gene symbol-
Locus tagVch1786_II0817
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]799486..800214 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVCA0021
DescriptionTsiV2
UniProt IDG7TVL5
KEGG IDvce:Vch1786_II0817
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 242 a.a.     [Download]
>gi|360038027|ref|YP_004939789.1| hypothetical protein Vch1786_II0817 [Vibrio cholerae O1 str. 2010EL-1786]
MLIDKNELEQLKVKLHSSEVIYQWDSVAYGERRSEIFRVFGAISAGIVPLWPFIFFADIQFNSKEFWGFI
CFSLAGMAAARYLFMPDHRYCYSLTQAGIYYTDQEVIPDAAYTFVRGFAWVGIAVCLLALAVVGPLAFVG
AGGFALLAFGLTNFHPTVHKKEVYFADQLIVFDPIKEKMVDLNTDSTDEPWFDRRLFFSSLDEKTHFIEL
VKSIHNNVDYLPLQRVNDQYKHPIFNQELKEE
-
Nucleotide Sequence: 729 bp     [Download]
>gi|360037214|ref|NC_016446.1|:799486-800214 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGTTAATTGATAAAAATGAGTTAGAGCAGTTAAAGGTAAAATTACACAGCAGTGAGGTTATTTATCAAT
GGGATAGTGTGGCTTACGGAGAGAGAAGATCTGAAATATTTCGCGTTTTTGGGGCAATCTCTGCTGGTAT
TGTTCCCCTTTGGCCATTTATTTTTTTTGCAGATATTCAATTTAATAGTAAAGAGTTTTGGGGATTTATC
TGCTTTAGTCTGGCGGGCATGGCTGCTGCCAGATATCTTTTTATGCCCGACCACCGTTATTGCTACAGTT
TAACGCAAGCGGGGATTTATTATACGGATCAAGAAGTGATCCCAGATGCGGCCTACACTTTTGTGCGTGG
TTTTGCTTGGGTGGGGATTGCGGTCTGTTTGTTAGCCTTAGCCGTCGTTGGCCCGTTAGCGTTTGTCGGT
GCGGGCGGTTTTGCCCTGCTGGCCTTTGGTTTGACCAACTTCCACCCCACCGTACATAAGAAAGAGGTTT
ACTTTGCTGACCAATTGATTGTTTTTGATCCCATCAAAGAAAAGATGGTGGATTTAAATACAGATAGCAC
AGATGAACCATGGTTTGACAGACGGCTATTTTTTAGTTCACTTGATGAGAAGACGCATTTTATTGAGCTC
GTGAAGAGTATTCATAATAATGTCGACTATCTTCCGTTACAGCGAGTTAACGATCAGTACAAGCATCCAA
TCTTTAATCAAGAATTAAAAGAGGAATAG