SecReT6
Immunity Protein ID: 378982814
SecReT6 ID553
T6SS typeA3
Gene symbol-
Locus tagSTMDT12_C02730
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. T000240
Repliconchromosome [GenBank: NC_016860] [Browse all T6SS(s) in this replicon]
Location [Strand]318205..318537 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTM0278
DescriptionTai4_TM
UniProt IDU3SCI4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 110 a.a.     [Download]
>gi|378982814|ref|YP_005245969.1| hypothetical protein STMDT12_C02730 [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240]
MLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIA
KKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
-
Nucleotide Sequence: 333 bp     [Download]
>gi|378982542|ref|NC_016860.1|:318205-318537 Salmonella enterica subsp. enterica serovar Typhimurium str. T000240, complete genome
ATGCTGGTATGGCAGCCATCCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAA
AAAATTGGGCGCTGAGTCATTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGC
TACGGCCAGTGCTTACCTTGAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCG
AAAAAATATTCAGGGTTGAAATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATT
TTATCCATGACAGGGAATTAAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA