SecReT6
Immunity Protein ID: 383495094
SecReT6 ID560
T6SS typeA3
Gene symbol-
Locus tagUMN798_0302
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 798
Repliconchromosome [GenBank: NC_017046] [Browse all T6SS(s) in this replicon]
Location [Strand]318178..318510 [+]
ProductSPI-6 associated protein
immunity typeProtein
Homologous immunitySTM0278
DescriptionTai4_TM
UniProt IDH8M580
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 110 a.a.     [Download]
>gi|383495094|ref|YP_005395783.1| SPI-6 associated protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 798]
MLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIA
KKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
-
Nucleotide Sequence: 333 bp     [Download]
>gi|383494824|ref|NC_017046.1|:318178-318510 Salmonella enterica subsp. enterica serovar Typhimurium str. 798 chromosome, complete genome
ATGCTGGTATGGCAGCCATCCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAA
AAAATTGGGCGCTGAGTCATTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGC
TACGGCCAGTGCTTACCTTGAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCG
AAAAAATATTCAGGGTTGAAATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATT
TTATCCATGACAGGGAATTAAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA