SecReT6
Immunity Protein ID: 383497076
SecReT6 ID560
T6SS typeA3
Gene symbol-
Locus tagUMN798_2563
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 798
Repliconchromosome [GenBank: NC_017046] [Browse all T6SS(s) in this replicon]
Location [Strand]2484363..2484881 [+]
Productlipoprotein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDH8LWY0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 1.60E-40, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|383497076|ref|YP_005397765.1| lipoprotein [Salmonella enterica subsp. enterica serovar Typhimurium str. 798]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFTNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRD
ADRGYEQPIYDAGAITQAEAWSAKVAPEYKKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|383494824|ref|NC_017046.1|:2484363-2484881 Salmonella enterica subsp. enterica serovar Typhimurium str. 798 chromosome, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCACGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTGGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGCTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGACAGGGGTTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCGA
AAGTCGCGCCGGAATATAAGAAGCATTAA