SecReT6
Immunity Protein ID: 386063393
SecReT6 ID616
T6SS typeA4a
Gene symbol-
Locus tagNCGM2_0422
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]469045..469866 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5088
DescriptionPA5088
UniProt IDG4LEY2
KEGG IDpnc:NCGM2_0422
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 4.60E-10, Aligned region: 25..31
Sel1 [PF08238], Evalue: 4.60E-10, Aligned region: 48..57
Sel1 [PF08238], Evalue: 4.60E-10, Aligned region: 59..89
Sel1 [PF08238], Evalue: 4.60E-10, Aligned region: 97..131
Sel1 [PF08238], Evalue: 4.60E-10, Aligned region: 133..164
Sel1 [PF08238], Evalue: 4.60E-10, Aligned region: 165..196
TPR_7 [PF13176], Evalue: 0.0019, Aligned region: 23..34
TPR_7 [PF13176], Evalue: 0.0019, Aligned region: 60..95
TPR_7 [PF13176], Evalue: 0.0019, Aligned region: 134..142
TPR_7 [PF13176], Evalue: 0.0019, Aligned region: 181..192
Protein Sequence: 273 a.a.     [Download]
>gi|386063393|ref|YP_005978697.1| hypothetical protein NCGM2_0422 [Pseudomonas aeruginosa NCGM2.S1]
MADSKPFICVNEKDHLPPLDPQADAWYREAVALAKPDTLRPWGRIVDLYSKAVERGHWKAMHNLANLYRT
GWPGGVEKDTQKALDLYQKMIDLEVPQGFYDMGAMIGNRAGVKNPATDGLTFLDKAASLGNPPALTELGK
LYIYVAKKKDLGLAYTHCAASQGYAPASYELGAYYKIVEHNFPKALGYYQASVSQGGKSAALFISGVFDK
ASPDVDRMWYAPDEKLHKLYDGIYDQLAADPDLRFPNLIKDHPLPPHPTQGYDADRPDWKPGQ
-
Nucleotide Sequence: 822 bp     [Download]
>gi|386062973|ref|NC_017549.1|:469045-469866 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGGCCGACAGTAAGCCGTTCATCTGCGTTAATGAGAAAGACCATTTGCCACCTCTCGATCCCCAGGCCG
ATGCCTGGTATCGGGAAGCAGTTGCGCTAGCTAAGCCTGACACCTTGCGTCCTTGGGGACGTATTGTGGA
CTTATACAGTAAGGCAGTTGAGCGTGGGCATTGGAAGGCGATGCATAATTTGGCGAATCTTTATCGCACA
GGGTGGCCCGGAGGGGTAGAAAAAGATACGCAGAAGGCATTGGATCTCTATCAAAAGATGATCGATCTGG
AGGTGCCCCAAGGGTTCTATGATATGGGAGCAATGATCGGCAATCGTGCAGGGGTCAAGAATCCTGCAAC
TGACGGGCTTACTTTTCTTGATAAGGCTGCTAGCCTAGGAAATCCGCCGGCACTAACCGAACTAGGTAAG
CTTTATATATATGTGGCCAAAAAAAAGGATTTGGGGTTGGCGTATACTCACTGTGCTGCTAGCCAGGGCT
ATGCGCCGGCTAGTTATGAGTTGGGGGCGTATTACAAGATAGTAGAGCATAATTTTCCAAAAGCATTGGG
TTATTATCAGGCGTCAGTCTCTCAGGGCGGAAAGAGTGCGGCTTTATTTATCTCCGGTGTTTTTGATAAA
GCCAGTCCTGATGTCGATAGAATGTGGTACGCCCCCGATGAGAAGCTGCACAAACTATATGATGGTATTT
ACGATCAACTTGCCGCTGATCCTGATTTGCGTTTTCCCAACTTGATAAAGGACCATCCTCTGCCTCCTCA
CCCGACCCAGGGCTACGACGCAGATCGGCCCGACTGGAAACCGGGGCAGTGA