SecReT6
Immunity Protein ID: 386063394
SecReT6 ID616
T6SS typeA4a
Gene symbol-
Locus tagNCGM2_0423
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]469923..470744 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5087
DescriptionPA5087
UniProt IDG4LEY3
KEGG IDpnc:NCGM2_0423
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 4.50E-13, Aligned region: 25..33
Sel1 [PF08238], Evalue: 4.50E-13, Aligned region: 46..57
Sel1 [PF08238], Evalue: 4.50E-13, Aligned region: 59..90
Sel1 [PF08238], Evalue: 4.50E-13, Aligned region: 97..131
Sel1 [PF08238], Evalue: 4.50E-13, Aligned region: 132..144
Sel1 [PF08238], Evalue: 4.50E-13, Aligned region: 165..196
TPR_7 [PF13176], Evalue: 0.007, Aligned region: 23..35
TPR_7 [PF13176], Evalue: 0.007, Aligned region: 60..95
TPR_7 [PF13176], Evalue: 0.007, Aligned region: 181..190
TPR_11 [PF13414], Evalue: 0.0072, Aligned region: 47..94
TPR_11 [PF13414], Evalue: 0.0072, Aligned region: 127..147
TPR_11 [PF13414], Evalue: 0.0072, Aligned region: 171..191
Protein Sequence: 273 a.a.     [Download]
>gi|386063394|ref|YP_005978698.1| hypothetical protein NCGM2_0423 [Pseudomonas aeruginosa NCGM2.S1]
MANSKPFVCANEKDHLPPLDPQADAWYREAAALAKPDTLRPWGRIVELYSKAVERGHWKAMHNLANLYRT
GWPGGVEKDPQKALDLYQKMIDLDVPQGFYDMGAMIGNRAGVKNPATDGLTFLDKAASLGNPPALTELGK
LYIYVAKEKELGVVYTSCASSQGYAPASYELGSYYELVEHNYPKALGYYQVSVSQGGRSAAFFLSRVFGK
RTPPSSAMWYTPDEKLEKFYYSLYLQIDADPDLRFPNLVKDNPLPPHPVQGYDAARPDWKPGQ
-
Nucleotide Sequence: 822 bp     [Download]
>gi|386062973|ref|NC_017549.1|:469923-470744 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGGCCAACAGCAAACCATTTGTCTGCGCTAATGAAAAAGACCATCTGCCGCCGTTGGATCCGCAAGCCG
ATGCTTGGTACCGCGAAGCAGCAGCCTTGGCCAAGCCCGATACTCTGCGGCCCTGGGGCCGTATCGTCGA
GCTTTACAGCAAGGCAGTGGAGCGCGGTCATTGGAAGGCCATGCATAATTTGGCGAATCTTTATCGTACA
GGGTGGCCCGGAGGAGTAGAAAAAGATCCGCAGAAGGCATTGGATCTCTATCAAAAGATGATAGATCTGG
ATGTGCCTCAGGGGTTCTATGATATGGGGGCAATGATTGGTAATCGTGCCGGTGTTAAGAACCCTGCTAC
CGATGGTCTGACCTTCTTGGATAAAGCCGCTAGTTTGGGGAACCCGCCAGCACTGACCGAGTTGGGTAAA
CTCTATATTTATGTGGCCAAGGAAAAGGAATTGGGGGTGGTGTATACCAGTTGTGCTTCCAGTCAAGGTT
ATGCTCCGGCGAGCTATGAGCTTGGAAGCTACTATGAGTTGGTTGAGCATAATTATCCAAAGGCACTTGG
CTACTATCAAGTCTCCGTCTCTCAAGGCGGCAGGAGTGCAGCCTTTTTTCTCTCGCGCGTCTTCGGAAAG
AGGACGCCTCCTTCAAGTGCAATGTGGTATACGCCGGATGAAAAGCTTGAGAAATTCTACTACTCCCTCT
ATCTGCAAATTGATGCCGACCCCGATCTTCGTTTTCCCAATTTGGTAAAAGATAACCCCTTGCCACCCCA
CCCCGTCCAGGGCTACGACGCAGCTCGACCCGACTGGAAGCCGGGTCAGTGA