SecReT6
Immunity Protein ID: 386067534
SecReT6 ID615
T6SS typeA1
Gene symbol-
Locus tagNCGM2_4630
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]4986706..4987740 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3488
DescriptionTli5
UniProt IDG4LRU4
KEGG IDpnc:NCGM2_4630
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 344 a.a.     [Download]
>gi|386067534|ref|YP_005982838.1| hypothetical protein NCGM2_4630 [Pseudomonas aeruginosa NCGM2.S1]
MTFEIPEEMEWATYDASRVWQISKGGGHNFTAEVTAVGDNGSYDYDSMIFYVSEKVDKNEFHNASNYIKG
TAEIYQDHLRENIKLDKKAISTLQKNKSEEKSIERIKKGIAEMEAKIPLAKIYEHDLGIPDSHILGSKNI
PFHVLLWRNQRVYYFTFSKPTENSAQRIKDLIARFRTRELYEVPNEPGICFPYGFIADDGKTAYELKNSL
RFTRTPNVIFSLLTASANDPWQTRPTSGLYDSDFRPGYDRQKWKKSALLDSLHIGKRLAAFEGWRLDPRP
DSGERERAWFGLAHTGGTLDPLVAIQVQTFQKGTDDLTDYTPPPEEVLPRLKALSQSIEQRLAR
-
Nucleotide Sequence: 1035 bp     [Download]
>gi|386062973|ref|NC_017549.1|:4986706-4987740 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGACCTTCGAGATACCGGAGGAGATGGAGTGGGCAACTTATGATGCCTCACGAGTCTGGCAGATATCCA
AAGGGGGGGGGCATAACTTTACCGCCGAGGTGACCGCCGTAGGTGACAACGGCAGCTATGACTACGACAG
TATGATTTTTTACGTTTCCGAAAAGGTTGATAAAAATGAATTCCATAACGCCTCAAACTACATAAAAGGA
ACAGCAGAAATATACCAAGACCATCTTAGAGAAAACATAAAACTAGATAAGAAAGCAATAAGTACGCTCC
AAAAAAACAAGAGCGAAGAGAAAAGTATTGAACGGATAAAAAAAGGAATCGCAGAAATGGAGGCCAAGAT
TCCTCTCGCCAAGATCTACGAACACGATCTCGGCATCCCCGACTCCCATATCCTTGGCAGCAAGAATATC
CCCTTCCATGTCCTGCTCTGGCGCAACCAGCGGGTCTATTACTTCACCTTCTCCAAGCCGACCGAGAACT
CCGCCCAGCGCATCAAGGACCTAATCGCCCGTTTCCGCACCCGCGAGCTTTACGAAGTGCCGAACGAACC
GGGCATCTGCTTCCCCTACGGCTTTATCGCCGACGACGGCAAGACCGCCTACGAACTGAAGAACAGCCTG
CGTTTCACCCGCACGCCCAACGTGATCTTCAGCCTGCTCACCGCCTCGGCCAACGATCCCTGGCAGACCC
GTCCCACCAGCGGCCTCTACGACAGCGACTTCCGTCCCGGCTACGACCGGCAGAAATGGAAAAAAAGCGC
GCTGCTCGACAGCCTCCACATCGGCAAGCGCCTGGCCGCCTTCGAAGGCTGGCGCCTCGACCCGCGCCCC
GACTCCGGCGAACGGGAACGCGCCTGGTTCGGCCTGGCCCATACAGGCGGCACCCTCGATCCGCTGGTAG
CGATCCAGGTGCAGACCTTCCAGAAAGGCACCGACGACCTCACCGACTACACCCCGCCCCCCGAAGAAGT
ACTGCCCCGCCTGAAGGCCCTGAGCCAAAGCATCGAGCAGCGGCTGGCGCGCTGA