SecReT6
Immunity Protein ID: 392986763
SecReT6 ID675
T6SS typeA4a
Gene symbol-
Locus tagPADK2_26925
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]5824383..5825264 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5087
DescriptionPA5087
UniProt IDI6SZZ5
KEGG IDpdk:PADK2_26925
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 4.50E-11, Aligned region: 45..53
Sel1 [PF08238], Evalue: 4.50E-11, Aligned region: 66..77
Sel1 [PF08238], Evalue: 4.50E-11, Aligned region: 79..110
Sel1 [PF08238], Evalue: 4.50E-11, Aligned region: 117..151
Sel1 [PF08238], Evalue: 4.50E-11, Aligned region: 153..184
Sel1 [PF08238], Evalue: 4.50E-11, Aligned region: 185..216
TPR_7 [PF13176], Evalue: 0.0017, Aligned region: 42..55
TPR_7 [PF13176], Evalue: 0.0017, Aligned region: 80..115
TPR_7 [PF13176], Evalue: 0.0017, Aligned region: 154..162
TPR_7 [PF13176], Evalue: 0.0017, Aligned region: 201..212
Protein Sequence: 293 a.a.     [Download]
>gi|392986763|ref|YP_006485350.1| hypothetical protein PADK2_26925 [Pseudomonas aeruginosa DK2]
MMRLMAIGLWVVLCLAGVPVMANSKSFVCVNEKDHLPPLDSQADAWYREAAALAKPDTLRPWGRIVELYS
KAVERGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLDVPQGFYDMGAMIGNRAGVKNPATDGL
TFLDKAASLGNPPALTELGKLYIYVAKKKDLGLAYTHCAASQGYAPASYELGAYYKIVEHNFPKALGYYQ
ASVSQGGKSAALFISGVFDKASPDVDRMWYAPDEKLHKLYDGIYDQLAADPDLRFPNLIKDHPLPPHPTQ
GYDVDRPDWKPER
-
Nucleotide Sequence: 882 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c5825264-5824383 Pseudomonas aeruginosa DK2 chromosome, complete genome
GTGATGCGGCTGATGGCTATTGGACTTTGGGTCGTGCTCTGTCTTGCAGGCGTCCCCGTGATGGCCAACA
GCAAATCGTTTGTCTGCGTTAATGAAAAAGACCATCTGCCGCCGTTGGATTCGCAAGCCGATGCTTGGTA
CCGCGAAGCAGCCGCCTTGGCCAAGCCCGATACTCTGCGGCCCTGGGGCCGTATCGTCGAGCTTTACAGT
AAGGCAGTGGAGCGCGGCCATTGGAAGGCCATGCATAATTTGGCGAATCTTTATCGTACAGGGTGGCCCG
GAGGAGTAGAAAAAGATACGCAGAAGGCATTGGATCTCTATCAAAAGATGATAGATCTGGATGTGCCTCA
GGGGTTCTATGATATGGGAGCAATGATTGGAAATCGCGCCGGGGTTAAAAACCCTGCAACTGACGGGCTT
ACTTTCCTTGATAAGGCTGCTAGCCTAGGAAATCCGCCGGCACTAACTGAACTAGGTAAGCTTTATATAT
ATGTGGCCAAAAAAAAGGATTTGGGGTTGGCGTATACTCACTGTGCTGCTAGTCAGGGTTATGCGCCGGC
TAGTTATGAGCTGGGGGCGTATTACAAGATAGTAGAGCATAATTTTCCAAAAGCATTGGGTTATTATCAG
GCGTCAGTCTCTCAGGGCGGAAAGAGTGCGGCTTTATTTATCTCCGGTGTTTTTGATAAAGCCAGTCCTG
ATGTCGATAGAATGTGGTACGCCCCCGATGAGAAGCTGCACAAACTATATGATGGTATTTACGATCAACT
TGCCGCTGATCCTGATTTGCGTTTTCCCAATTTGATAAAGGACCATCCTCTGCCTCCTCACCCGACCCAA
GGCTACGACGTGGACCGCCCAGACTGGAAGCCGGAGCGGTAA