SecReT6
Immunity Protein ID: 392986764
SecReT6 ID675
T6SS typeA4a
Gene symbol-
Locus tagPADK2_26930
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]5825261..5826142 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5088
DescriptionPA5088
UniProt IDI6SQX8
KEGG IDpdk:PADK2_26930
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 45..52
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 68..77
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 79..109
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 117..151
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 152..183
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 185..217
Protein Sequence: 293 a.a.     [Download]
>gi|392986764|ref|YP_006485351.1| hypothetical protein PADK2_26930 [Pseudomonas aeruginosa DK2]
MIRLMAIGIWAVLCLAAVPAMADSKPFVCVNEKDHLPPLDPQADAWYREAATLAKPDTLRPWPRIVDLYS
KAVERGHWKAMHNLASLYRTGWPGGVEKDTQKALDLYQKMIDLKVPQGFYDMAAMIGSRAGVKNPATDGL
TFLDKAASLGNPPALTELGRLYIYVAGQDELGLKYTNCAAGQGYAPANYELAMYYRLVAHNYPKAAGYYL
LAASQGNNDAAFFMSGVFDKTSPDVDRMWYAPDERLHKLYDGIYDQLSADPDLRFPNLIKDHPLPPHPTQ
GYDADRPDWKSGQ
-
Nucleotide Sequence: 882 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c5826142-5825261 Pseudomonas aeruginosa DK2 chromosome, complete genome
GTGATTCGGCTAATGGCTATTGGAATATGGGCTGTACTTTGTCTCGCAGCAGTTCCCGCTATGGCTGACA
GCAAGCCTTTTGTCTGCGTTAACGAAAAGGACCATCTACCCCCTCTGGACCCGCAGGCCGATGCTTGGTA
TCGCGAAGCGGCGACCCTGGCCAAGCCCGATACCTTGCGTCCGTGGCCTCGTATCGTCGATCTATACAGT
AAGGCAGTTGAGCGTGGTCACTGGAAGGCTATGCATAACTTGGCGAGCCTCTATCGTACCGGTTGGCCAG
GCGGTGTGGAGAAGGATACTCAGAAAGCTCTAGATCTCTACCAGAAGATGATCGATTTGAAGGTTCCTCA
AGGTTTCTACGATATGGCGGCAATGATCGGGAGTCGCGCTGGCGTCAAGAATCCTGCGACTGATGGACTT
ACTTTTCTCGATAAGGCTGCAAGCTTGGGTAATCCACCAGCATTAACTGAGTTAGGAAGGCTATATATAT
ATGTTGCTGGTCAGGATGAGTTGGGGCTGAAATACACGAACTGTGCTGCAGGCCAGGGCTATGCTCCTGC
CAATTACGAACTGGCGATGTACTATCGTTTGGTGGCACATAACTACCCAAAGGCGGCAGGCTATTACCTT
CTTGCTGCAAGCCAAGGAAATAATGATGCTGCCTTCTTCATGTCCGGAGTTTTTGATAAGACTAGTCCCG
ATGTTGACAGAATGTGGTACGCCCCCGATGAGAGGCTACACAAACTATATGATGGTATTTACGACCAACT
TTCCGCTGATCCTGATTTGCGTTTTCCCAACTTGATAAAGGACCATCCTCTGCCTCCTCACCCGACCCAG
GGCTACGACGCAGATCGGCCCGACTGGAAATCGGGGCAGTGA