SecReT6
Immunity Protein ID: 392986765
SecReT6 ID675
T6SS typeA4a
Gene symbol-
Locus tagPADK2_26935
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]5826139..5827014 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5087
DescriptionPA5087
UniProt IDI6S5Q2
KEGG IDpdk:PADK2_26935
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 3.00E-11, Aligned region: 44..49
Sel1 [PF08238], Evalue: 3.00E-11, Aligned region: 66..75
Sel1 [PF08238], Evalue: 3.00E-11, Aligned region: 77..112
Sel1 [PF08238], Evalue: 3.00E-11, Aligned region: 115..149
Sel1 [PF08238], Evalue: 3.00E-11, Aligned region: 150..162
Sel1 [PF08238], Evalue: 3.00E-11, Aligned region: 183..214
TPR_6 [PF13174], Evalue: 0.0097, Aligned region: 55..68
TPR_6 [PF13174], Evalue: 0.0097, Aligned region: 78..110
TPR_6 [PF13174], Evalue: 0.0097, Aligned region: 187..208
Protein Sequence: 291 a.a.     [Download]
>gi|392986765|ref|YP_006485352.1| hypothetical protein PADK2_26935 [Pseudomonas aeruginosa DK2]
MRFFSWLIVFLMIFGAPSMAETKPFVCVNEKDHLPPLDPQADAWYSEAVSLAKPDALRPWERIVDLYSKA
MERGHWKAMHNLANLYRTGWPGGVEKDTQKALDIYQKMIDLGVPQGFYDMGAMIGNRAGVKNPATDGLTF
LDKAASLGNPPALTELGKLYIYVAKEKELGLAYTSCASSQGYAPASYELGSYYELVEHNYPKALRYYQVS
VSQGGRSAAFFLSRVFGKRTPPSSAMWYTPDEKLEKFYYSLYLQIDADTDLRFPNLVKDNPLPPHPVQGY
DAARPDWKPGQ
-
Nucleotide Sequence: 876 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c5827014-5826139 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGCGTTTTTTTTCTTGGCTGATTGTATTCCTGATGATCTTCGGAGCTCCCTCTATGGCTGAGACCAAGC
CCTTTGTCTGTGTCAATGAAAAAGACCATCTTCCCCCGCTGGATCCGCAGGCTGACGCATGGTATAGCGA
GGCGGTAAGCCTAGCCAAGCCTGACGCTCTGCGGCCGTGGGAGCGCATTGTCGATTTGTACAGCAAAGCA
ATGGAGCGTGGCCATTGGAAGGCGATGCATAACCTGGCAAATCTCTATCGAACGGGGTGGCCTGGTGGAG
TAGAGAAGGATACACAGAAAGCTCTGGATATTTACCAGAAGATGATCGACCTAGGAGTACCCCAAGGTTT
CTATGACATGGGGGCAATGATTGGTAATCGTGCCGGTGTTAAGAACCCTGCTACCGATGGTCTGACCTTC
TTGGATAAAGCCGCTAGTTTGGGGAACCCGCCAGCACTGACCGAGTTGGGTAAACTCTATATTTATGTGG
CCAAGGAAAAGGAATTGGGGCTGGCGTATACCAGTTGTGCTTCCAGTCAAGGTTATGCTCCGGCGAGCTA
TGAGCTTGGAAGCTACTATGAGTTGGTTGAGCATAATTATCCAAAGGCACTTAGATACTATCAAGTCTCC
GTCTCTCAAGGCGGCAGGAGTGCCGCCTTTTTTCTCTCGCGCGTCTTCGGAAAGAGGACGCCTCCTTCAA
GTGCAATGTGGTATACGCCGGATGAAAAGCTTGAGAAATTCTACTACTCCCTCTATCTGCAAATTGATGC
CGACACCGATCTTCGTTTTCCCAATTTGGTAAAAGATAACCCCTTGCCACCCCACCCCGTCCAGGGCTAC
GACGCAGCTCGACCCGACTGGAAGCCGGGTCAGTGA