SecReT6
Immunity Protein ID: 448244441
SecReT6 ID731
T6SS typeA3
Gene symbol-
Locus tagSMWW4_v1c46880
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]5078773..5079351 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunitySMA3979
DescriptionSip4
UniProt IDL7ZS12
KEGG IDsmw:SMWW4_v1c46880
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 192 a.a.     [Download]
>gi|448244441|ref|YP_007408494.1| hypothetical protein SMWW4_v1c46880 [Serratia marcescens WW4]
MADWMIKRLIAQGREMESQIAARDRALFAGVDAQLEQHFLTPGQRLSPPGVGNVMLLMVCLTLGLAGVMG
LATDVAAAWSGKTSAAVLMGSGAIVAVWMTLILFQLVQGKNSGVVLLQYYLGMLGLCCLGAAVAWATGMT
GIATGAMLLGGAVGGALFSNRAAFYLYVAYFRTRRRVFIKRRWQREDLRNTR
-
Nucleotide Sequence: 579 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c5079351-5078773 Serratia marcescens WW4, complete genome
ATGGCGGACTGGATGATTAAACGCCTGATCGCGCAGGGCCGGGAGATGGAAAGCCAAATCGCGGCGCGCG
ATCGCGCGCTTTTCGCCGGCGTGGATGCGCAGCTTGAGCAGCATTTCCTGACGCCGGGCCAGCGGCTGTC
ACCGCCGGGCGTCGGCAATGTCATGTTGCTGATGGTATGCCTGACGCTGGGGCTGGCGGGCGTGATGGGC
CTGGCCACGGACGTGGCGGCCGCCTGGAGCGGCAAGACTTCCGCCGCCGTTCTCATGGGCAGCGGCGCGA
TCGTGGCGGTGTGGATGACGCTGATCCTGTTCCAACTGGTGCAGGGGAAAAACAGCGGAGTGGTATTGCT
GCAATACTATCTTGGCATGCTCGGTCTGTGTTGCCTTGGCGCCGCAGTAGCGTGGGCGACGGGCATGACC
GGCATCGCCACCGGTGCCATGTTGCTGGGGGGCGCGGTGGGTGGTGCGCTATTCAGCAATCGGGCGGCGT
TCTACCTGTATGTCGCTTATTTTCGCACGCGTCGGCGCGTGTTTATCAAACGCCGTTGGCAGAGGGAAGA
TCTGCGCAACACCCGATAA