SecReT6
Immunity Protein ID: 470152658
SecReT6 ID649
T6SS typeA1
Gene symbol-
Locus tagW5S_0149
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]177785..178192 [+]
ProductHypothetical protein
immunity typeProtein
Homologous immunityDda3937_01757
DescriptionRhsIA
UniProt IDK4FED3
KEGG IDpec:W5S_0149
PDB IDNA
Domain hit(s) vs Pfam Imm-NTF2 [PF15655], Evalue: 4.20E-33, Aligned region: 5..134
Protein Sequence: 135 a.a.     [Download]
>gi|470152658|ref|YP_006281160.1| Hypothetical protein W5S_0149 [Pectobacterium sp. SCC3193]
MDELSKAEAVLKEFIIQMNRWELKYYPLFRNEGMTVHKDTAKKYLDDIYDLFCTKKERKQGRQVSLSCGE
PPEYSPDEEILSSELNKNKAIFVTQQYTEAKNKFRYTINIKEGEWRIDKKERFSSFEDKWIKYNL
-
Nucleotide Sequence: 408 bp     [Download]
>gi|470152509|ref|NC_017845.1|:177785-178192 Pectobacterium sp. SCC3193, complete genome
ATGGACGAATTATCTAAAGCAGAGGCAGTTCTAAAAGAATTTATCATCCAAATGAATAGGTGGGAGTTGA
AATATTACCCATTGTTTAGAAATGAAGGGATGACGGTGCATAAAGACACAGCAAAAAAATATCTTGATGA
CATATATGATCTTTTTTGCACAAAAAAAGAAAGAAAACAAGGCAGGCAAGTATCATTGTCGTGTGGCGAA
CCACCAGAGTATTCGCCAGACGAAGAAATATTAAGTAGCGAATTAAATAAAAATAAAGCGATATTTGTAA
CTCAACAGTATACCGAAGCTAAAAATAAATTTCGTTATACCATTAATATTAAAGAGGGTGAATGGCGTAT
TGATAAAAAAGAACGATTTAGCTCATTTGAAGACAAATGGATAAAATACAATCTGTAG