SecReT6
Immunity Protein ID: 488653036
SecReT6 ID763
T6SS typeA3
Gene symbol-
Locus tagTY21A_02485
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]561892..562410 [-]
Productputative lipoprotein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDN0BZU3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 3.90E-40, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|488653036|ref|YP_007924839.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFMNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRD
ADKDYEQPIYDAGAITQAEAWSAKVAPEYEKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|488652559|ref|NC_021176.1|:c562410-561892 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCATGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTAGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGCTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGATAAGGATTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCAA
AAGTCGCGCCGGAATATGAGAAGCATTAA