SecReT6
Immunity Protein ID: 488655077
SecReT6 ID763
T6SS typeA3
Gene symbol-
Locus tagTY21A_13125
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]2665037..2665462 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTY0301
DescriptionTai2_TY
UniProt IDN0C4J8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|488655077|ref|YP_007926880.1| hypothetical protein TY21A_13125 [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
MQKPILSLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPIISSAEGWNVSSRAARMLNDGGFLSSG
DPKEQADLKGEDAVVDGKKGHLWEIDPEDNRRGIWFSCSYGQWAVLLARKVQGTVATCWSPDVLPAKLIC
K
-
Nucleotide Sequence: 426 bp     [Download]
>gi|488652559|ref|NC_021176.1|:c2665462-2665037 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
ATGCAGAAGCCTATTTTATCGTTGAATAGCACCTGTATTGTCGGGGGCATTCTGTGGTTACTTCCGGTAA
TAGTTGTTCATGCCGATGAGATTGTCTGCCCTGCGGTTATTCATTTTTCTCAGGCTCCAATAATTTCCTC
AGCGGAAGGATGGAATGTCTCATCCCGTGCAGCGCGTATGTTGAATGATGGTGGTTTTCTTTCGTCTGGC
GATCCCAAAGAGCAGGCAGATCTGAAAGGTGAAGATGCAGTCGTTGATGGGAAAAAGGGGCACCTGTGGG
AGATAGACCCAGAGGATAATCGCCGGGGGATCTGGTTCTCGTGTAGTTATGGACAGTGGGCTGTTCTGCT
TGCCAGAAAAGTTCAGGGAACGGTTGCGACATGCTGGAGCCCGGATGTCTTACCGGCGAAATTGATTTGT
AAATAA