SecReT6
Immunity Protein ID: 50083348
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD0054
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]56618..57070 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityACIAD0054
DescriptionThe protein encoded downstream of Tpe1, Tpi1 (ACIAD0054), contains a predicted N-terminal transmembrane helix, and it is the cognate immunity protein to Tpe1.
UniProt IDQ6FFX1
KEGG IDaci:ACIAD0054
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 150 a.a.     [Download]
>gi|50083348|ref|YP_044858.1| hypothetical protein ACIAD0054 [Acinetobacter sp. ADP1]
MNMKEKKIVGYIIIGFFLIYIISFFIRNENEKFTISLVNNNLLIKFPNKIFVKDYAIKDYEETNQSNINK
IFEYKTILEKEYYQEVNEVFIRDISNYGIKENHAYFYTMFQEDNKNSSKKLKSLGFCIKKDFVLVQGSRE
KDSDFINKCH
-
Nucleotide Sequence: 453 bp     [Download]
>gi|50083297|ref|NC_005966.1|:56618-57070 Acinetobacter sp. ADP1 chromosome, complete genome
ATGAACATGAAAGAAAAAAAAATAGTTGGATATATCATTATAGGATTTTTTTTAATTTATATTATTTCTT
TTTTCATTAGGAATGAGAATGAAAAATTTACTATTAGCCTTGTTAATAATAATCTATTGATTAAATTTCC
TAATAAGATATTTGTTAAAGATTATGCAATAAAGGACTATGAGGAAACTAATCAATCAAATATCAATAAA
ATATTTGAGTACAAAACAATTTTGGAAAAAGAATACTATCAAGAAGTTAATGAAGTTTTTATAAGAGATA
TATCAAATTATGGTATTAAAGAAAATCATGCTTATTTCTATACTATGTTTCAAGAGGATAATAAAAACTC
TAGTAAAAAATTAAAATCACTCGGCTTCTGTATAAAAAAAGATTTTGTTCTCGTACAGGGTAGTAGGGAA
AAAGATAGTGACTTTATAAACAAGTGCCATTAA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature