SecReT6
Immunity Protein ID: 50083454
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD0169
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]172382..173107 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityACIAD0169
DescriptionTai1 (ACIAD0169) carries a predicted cleavable N-terminal signal sequence, suggesting that Tai1 is the cognate immunity protein of Tae1.
UniProt IDQ6FFL5
KEGG IDaci:ACIAD0169
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 241 a.a.     [Download]
>gi|50083454|ref|YP_044964.1| hypothetical protein ACIAD0169 [Acinetobacter sp. ADP1]
MFSRYVVGTGLVLLVFGSTISACADSSSVDCNKNNVYESIQCIEKENKKLIIKLDNEKNREKNDYNKWVK
KIKNNCEGKISHIAGEGAGLVRNQCYRDEYLSRLSFLTTGKTSKEENIHGLVVTHLPYNSVDHFKCLLKK
DINSCSKVNLVSSSNLIKFYPSISPNYGDGIVLPETESGKQIIISPFEDNEDEGPQLAILIINAFGVEEK
KFIPATKNVLIDKNYNLTYMEGNKEKRIQLK
-
Nucleotide Sequence: 726 bp     [Download]
>gi|50083297|ref|NC_005966.1|:172382-173107 Acinetobacter sp. ADP1 chromosome, complete genome
ATGTTTAGTAGATATGTGGTTGGTACAGGATTAGTATTATTAGTATTTGGTTCAACAATATCAGCATGTG
CGGATAGTTCATCAGTAGATTGTAATAAAAATAATGTTTATGAAAGTATACAATGTATAGAAAAGGAAAA
TAAAAAATTAATTATTAAACTTGATAATGAAAAAAATAGAGAAAAAAATGATTATAATAAATGGGTGAAG
AAAATAAAAAATAATTGTGAAGGAAAAATAAGTCATATAGCTGGGGAAGGTGCAGGTCTAGTTAGAAATC
AATGTTATAGAGATGAGTATTTATCTAGATTATCATTTTTAACAACTGGAAAAACTTCGAAAGAAGAAAA
TATTCATGGTTTAGTGGTAACACATTTACCTTACAATTCAGTTGATCATTTTAAATGTCTTTTAAAGAAA
GATATAAATAGTTGTTCTAAAGTTAATTTGGTGAGCTCATCTAATTTGATAAAATTCTATCCATCTATTT
CTCCAAATTATGGGGATGGTATTGTTCTTCCAGAAACAGAAAGTGGTAAACAAATCATTATTTCTCCATT
TGAAGATAATGAGGATGAGGGTCCACAACTTGCGATTTTAATCATTAATGCTTTTGGTGTAGAAGAAAAG
AAATTTATCCCAGCAACTAAAAATGTATTAATCGATAAGAATTATAATTTAACTTATATGGAAGGTAATA
AAGAAAAGCGAATACAGTTGAAATAA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature