SecReT6
Immunity Protein ID: 50084944
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD1796
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]1803547..1804635 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityACIAD1796
DescriptionTsi1b
UniProt IDQ6FBD1
KEGG IDaci:ACIAD1796
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 362 a.a.     [Download]
>gi|50084944|ref|YP_046454.1| hypothetical protein ACIAD1796 [Acinetobacter sp. ADP1]
MLREDYENKFTTLNQPFEIGTPNKNGRLRLREIDIKNLKTDQLYPHRQVIRFNSTFVEVMDSWEFIRGRA
TALALPMWAALFFAISMFLFAIYSLYFKQVYWSIAIISCLTIGLVYLVYSNYKMAKYDLFGYTHYPIRFN
RKTQKVYAFSPQQQKIIELNWQDLRFSAVQEGRFDIELRASLVNEDNIVEEEIIFPFITKIYGKELVDHH
LAFFKAYMQGDDLKSIDAAIPEFFDVYNRKETFKESFERVYMQFDGEEIIQQTRPAERDNGIATVAFPLF
SLILLRRLGVYFSKIPQWPTHIEKECQIDSNDPYDSTGKQRHLSPLVFTSAEKLILFLGWFLGTSIFIAF
LAGLAYLSWNYR
-
Nucleotide Sequence: 1089 bp     [Download]
>gi|50083297|ref|NC_005966.1|:1803547-1804635 Acinetobacter sp. ADP1 chromosome, complete genome
ATGTTAAGAGAAGACTACGAAAACAAGTTTACGACACTCAATCAACCCTTTGAAATTGGGACTCCCAATA
AAAACGGACGTTTACGTTTAAGGGAGATTGATATAAAAAACCTGAAAACGGATCAGCTTTATCCCCATCG
TCAGGTTATTCGTTTTAATTCTACTTTTGTGGAGGTCATGGATAGCTGGGAGTTTATTCGTGGACGCGCA
ACAGCATTAGCACTTCCAATGTGGGCCGCATTATTTTTTGCGATTTCTATGTTTTTATTTGCTATATATA
GCCTGTATTTTAAACAAGTTTATTGGAGTATCGCTATAATTTCGTGCCTAACGATTGGTTTGGTTTATTT
AGTCTATTCGAATTATAAGATGGCAAAGTATGATTTATTTGGCTATACGCATTACCCAATCCGTTTTAAC
CGTAAGACCCAGAAAGTATATGCTTTTTCACCTCAACAACAAAAAATCATTGAGCTAAACTGGCAGGATT
TACGTTTTTCTGCTGTACAAGAAGGACGGTTTGATATCGAGTTAAGAGCAAGTTTAGTAAATGAGGATAA
TATTGTAGAAGAAGAAATAATTTTTCCTTTTATTACAAAAATATATGGAAAAGAATTGGTCGATCACCAT
TTGGCATTCTTTAAAGCTTATATGCAAGGCGATGATCTAAAAAGTATAGATGCGGCTATTCCAGAGTTTT
TTGATGTTTATAACAGGAAAGAAACTTTTAAAGAGAGCTTTGAACGAGTTTATATGCAGTTTGATGGTGA
AGAAATCATCCAGCAAACCCGCCCTGCTGAACGAGATAATGGAATAGCAACAGTTGCTTTTCCTTTATTC
TCACTCATTTTATTAAGACGCTTGGGAGTATATTTTTCAAAAATACCTCAATGGCCTACCCATATTGAAA
AAGAATGTCAGATTGATAGTAATGACCCTTATGACTCAACAGGGAAACAACGCCATCTTTCACCATTAGT
GTTTACTTCGGCTGAAAAACTTATTTTGTTTCTAGGTTGGTTCCTAGGAACAAGTATCTTTATCGCATTT
CTGGCAGGATTGGCTTATTTAAGTTGGAATTATAGATAA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature