SecReT6
Immunity Protein ID: 50086116
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD3112
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]3038267..3039250 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityACIAD3112
DescriptionTsi2a
UniProt IDQ6F811
KEGG IDaci:ACIAD3112
PDB IDNA
Domain hit(s) vs Pfam FGE-sulfatase [PF03781], Evalue: 2.1e-30, Aligned region: 52-269
Protein Sequence: 327 a.a.     [Download]
>gi|50086116|ref|YP_047626.1| hypothetical protein ACIAD3112 [Acinetobacter sp. ADP1]
MTYKKMMKQNLVIFLFSTLALNACAKSRETSTKAAQPSAELQQKIQKLVEKTQKNMIFVEGGSFMMGDFG
HVTRKDKLPITGLYVAMPLHKVTLDSFSLNAYKTTFDEFDIYTEATGQKKIAMQEISKKLRVPNAPAGVS
WQQAHDYCQWLGQQVGIPMTLPTEAQWEYAARNRGQYVIYPTDNGEYEPGRNVWSDEQRREFTKSMPDIH
GVKVPTLGRFPPTPLGFYDLATDSYEWMSDWFDPQYYKHSPEKNPQGPATGTLKSVRSTYQEAGVLDLKI
GGSVTTIYRYGVEPNPKFDKDDNAFNTINPNSATAVRCASNSHKPFI
-
Nucleotide Sequence: 984 bp     [Download]
>gi|50083297|ref|NC_005966.1|:3038267-3039250 Acinetobacter sp. ADP1 chromosome, complete genome
ATGACTTATAAAAAGATGATGAAACAAAATCTTGTAATTTTTTTATTTTCAACTCTTGCTTTAAATGCCT
GTGCAAAATCGAGAGAAACATCCACCAAAGCAGCTCAGCCTTCAGCCGAATTACAACAAAAAATTCAAAA
GCTCGTTGAGAAAACCCAAAAAAATATGATTTTTGTTGAGGGTGGAAGCTTTATGATGGGTGATTTTGGT
CATGTCACACGTAAAGATAAATTACCTATCACTGGCCTTTATGTAGCCATGCCTTTACATAAAGTCACCC
TCGATAGTTTTAGTTTAAATGCGTATAAAACCACCTTTGATGAGTTTGATATTTATACTGAAGCGACTGG
GCAGAAAAAAATTGCAATGCAAGAAATTTCCAAAAAGTTACGCGTACCAAATGCACCCGCAGGTGTGAGC
TGGCAACAAGCACACGATTACTGTCAATGGCTAGGCCAACAAGTTGGAATACCTATGACCCTACCAACCG
AAGCGCAATGGGAATATGCTGCCAGAAACCGTGGGCAATATGTTATCTATCCAACGGATAATGGTGAATA
TGAGCCGGGACGAAATGTTTGGAGTGATGAACAAAGACGTGAATTTACTAAATCTATGCCCGATATTCAT
GGAGTAAAAGTTCCGACACTTGGTCGGTTTCCTCCGACACCTTTAGGCTTTTATGACTTAGCAACTGATA
GCTATGAATGGATGTCGGATTGGTTTGATCCTCAATATTATAAGCATTCACCAGAGAAAAACCCTCAAGG
CCCAGCGACAGGGACACTCAAATCGGTTCGAAGCACTTATCAGGAGGCTGGTGTTTTAGATCTAAAAATT
GGCGGTAGTGTAACAACAATTTATAGATATGGTGTGGAACCTAATCCTAAATTTGATAAGGATGACAATG
CTTTCAATACTATTAACCCAAATAGTGCAACCGCTGTAAGATGCGCCTCTAACTCGCATAAACCATTTAT
CTAA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature