SecReT6
Immunity Protein ID: 50086117
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD3113
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]3039389..3040372 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityACIAD3113
DescriptionTsi2b
UniProt IDQ6F810
KEGG IDaci:ACIAD3113
PDB IDNA
Domain hit(s) vs Pfam FGE-sulfatase [PF03781], Evalue: 3.0e-31, Aligned region: 57-276
Protein Sequence: 327 a.a.     [Download]
>gi|50086117|ref|YP_047627.1| hypothetical protein ACIAD3113 [Acinetobacter sp. ADP1]
MTYKKMMKQNLVIFLISSLSLSACAKSDATQKTSTPVTKQDLSSEQKKQLQQLLEKTKKNLIFVKGGSFK
MGDFGPEHSIDKLPYDSNGDSKPLHKVTLDDFYLSATKATYADFDVYTDVTGQKPIGNFNEVTKKYRIPT
SAAGINWQQARNYCQWLGTQLNLKMDLPTEAQWEYAARNRGQYILYPTDNGKIDNGRNVWSFEQRQASKK
PFKVTKSISLLQKFPPTPLGLYDMITDNYEWILDWYDPEYYSKSPEKNPQGPNTGTLKVVRSSAPADGQP
LQTFTGKTISRHAMDPMADPELVKESKNQKYYFDFNLNNSVRCVANP
-
Nucleotide Sequence: 984 bp     [Download]
>gi|50083297|ref|NC_005966.1|:3039389-3040372 Acinetobacter sp. ADP1 chromosome, complete genome
ATGACTTATAAAAAGATGATGAAACAAAATCTTGTAATTTTTTTAATTTCAAGCCTTTCGCTTAGTGCAT
GTGCCAAATCAGATGCTACTCAAAAAACTTCTACACCAGTAACAAAACAAGACCTTTCTTCTGAACAAAA
AAAGCAATTACAACAATTGCTTGAGAAAACAAAAAAAAATCTGATCTTTGTGAAAGGTGGAAGTTTTAAG
ATGGGTGACTTTGGTCCAGAACATAGTATTGATAAACTCCCATACGACAGTAATGGAGATAGCAAACCTC
TTCATAAGGTCACTTTGGATGATTTTTATTTAAGTGCCACCAAAGCCACTTATGCCGATTTTGATGTATA
TACTGATGTCACAGGACAAAAACCTATTGGCAATTTTAACGAAGTAACAAAAAAATATCGTATTCCAACT
TCTGCAGCAGGGATCAACTGGCAACAAGCTCGAAATTATTGCCAATGGCTTGGTACGCAACTCAATTTAA
AGATGGATTTACCAACAGAAGCACAATGGGAATATGCGGCACGTAACCGCGGACAATATATTCTATATCC
AACAGATAATGGAAAAATTGATAATGGCCGTAATGTTTGGAGCTTTGAACAAAGACAAGCATCTAAAAAA
CCATTTAAAGTAACTAAAAGTATTTCCTTATTACAAAAATTTCCACCAACACCATTGGGTCTATACGATA
TGATCACAGATAATTATGAGTGGATACTGGACTGGTATGATCCTGAGTATTACAGTAAATCTCCAGAGAA
AAACCCTCAAGGTCCAAACACGGGAACTTTAAAAGTAGTACGAAGTTCTGCACCAGCAGATGGACAACCA
TTGCAAACATTTACTGGCAAAACTATTAGTAGACATGCAATGGATCCGATGGCAGATCCTGAATTAGTCA
AAGAGTCTAAGAATCAGAAATATTACTTTGATTTTAACTTAAATAATTCAGTACGTTGTGTAGCCAATCC
TTAA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature