SecReT6
Immunity Protein ID: 50086394
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD3426
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]3341328..3342386 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityACIAD3426
DescriptionTli1 carries a predicted cleavable N-terminal signal sequence as is common for the cognate phospholipase immunity proteins (Russell et al., 2013).
UniProt IDQ6F783
KEGG IDaci:ACIAD3426
PDB IDNA
Domain hit(s) vs Pfam Tli4_C [PF18426], Evalue: 4.9e-15, Aligned region: 182-347
Tli4_N [PF18443], Evalue: 3.8e-06, Aligned region: 39-176
Protein Sequence: 352 a.a.     [Download]
>gi|50086394|ref|YP_047904.1| hypothetical protein ACIAD3426 [Acinetobacter sp. ADP1]
MKLLKRLTLCLLTTVSFSACSNVEKEQEGIKVIDYRNPKKVCFGRIELTVPKETEVEYSNFNYNGSNIEV
DESVKTYEAYQKLINDKIEYLKHEPHETEGVLLKQEMPGPVNQLNRSVSHIIVFRDGLYVTSAYEVYGYL
YLGPKRLVVLKSGASNDLLNEAIEDMKQTLRSIKIKSAKGEDQAGLCWKDFFIVDDMSKNIPFGGGYLHF
KFPSYPQVRADVVYRVTYDSDLHLIEMMKKNQKELPAIAKALMSIENLREHKKIINGLGGEEVLNHMSRR
GYFERGYEVGEWQYLGTLDNHNDPYIQFSFDSADMVRPDDPLNSTISQKEALRLNDFILNSIRITPNNEK
EK
-
Nucleotide Sequence: 1059 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c3342386-3341328 Acinetobacter sp. ADP1 chromosome, complete genome
ATGAAATTATTAAAGCGCTTAACCCTTTGCTTATTAACAACAGTTTCTTTTAGTGCATGTTCAAATGTTG
AAAAAGAACAAGAAGGAATTAAAGTGATCGATTATCGTAATCCTAAAAAAGTGTGTTTCGGCCGAATTGA
ATTAACGGTTCCGAAAGAAACAGAAGTTGAATACAGTAACTTCAACTACAACGGCAGTAATATAGAAGTA
GATGAAAGTGTAAAAACATACGAAGCATATCAAAAATTGATTAATGACAAGATTGAGTATTTAAAGCATG
AGCCGCATGAAACAGAAGGCGTTTTATTAAAACAAGAAATGCCAGGCCCAGTAAATCAGCTTAACCGTTC
TGTTAGTCATATTATTGTTTTTCGAGATGGGTTGTATGTGACATCAGCTTATGAAGTTTATGGTTACCTT
TATCTAGGCCCGAAAAGATTAGTTGTTCTTAAAAGTGGAGCAAGTAATGATTTATTGAATGAGGCTATTG
AGGACATGAAACAAACTTTAAGAAGTATAAAAATAAAATCGGCTAAAGGCGAAGATCAAGCCGGTTTATG
TTGGAAGGATTTTTTTATTGTAGACGATATGAGCAAAAACATTCCGTTTGGGGGAGGATATTTACATTTC
AAATTCCCTAGTTATCCGCAAGTTCGGGCTGATGTCGTATATCGTGTAACCTATGACTCGGATTTGCACT
TAATTGAAATGATGAAAAAGAACCAGAAAGAGTTACCTGCCATTGCGAAAGCCTTGATGAGCATTGAGAA
TCTCAGAGAACATAAAAAGATAATCAATGGTTTGGGTGGTGAAGAGGTGCTAAATCATATGTCCAGACGT
GGATATTTTGAAAGAGGCTATGAAGTAGGAGAATGGCAGTATCTAGGCACACTAGATAACCATAATGACC
CTTATATTCAGTTTAGTTTTGATAGTGCAGACATGGTAAGACCTGACGACCCACTCAATTCAACAATAAG
CCAGAAAGAAGCTCTTCGACTGAATGATTTTATTTTAAACAGTATCCGAATTACACCGAATAATGAAAAA
GAGAAATAA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature