SecReT6
Immunity Protein ID: 525827694
SecReT6 ID821
T6SS typeA3
Gene symbol-
Locus tagCFSAN002069_07750
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
Repliconchromosome [GenBank: NC_021812] [Browse all T6SS(s) in this replicon]
Location [Strand]804280..804663 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTM0278
DescriptionTai4_TM
UniProt IDS5HUD3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|525827694|ref|YP_008250385.1| hypothetical protein CFSAN002069_07750 [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYL
EYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
-
Nucleotide Sequence: 384 bp     [Download]
>gi|559996969|ref|NC_021812.2|:804280-804663 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069, complete genome
GTGGATACTGCCGTGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCAT
CCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAATTGGGCGCTGAGTCA
TTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTT
GAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGA
AATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATTTTATCCATGACAGGGAATT
AAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA