SecReT6
Immunity Protein ID: 525829595
SecReT6 ID821
T6SS typeA3
Gene symbol-
Locus tagCFSAN002069_19965
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
Repliconchromosome [GenBank: NC_021812] [Browse all T6SS(s) in this replicon]
Location [Strand]2964745..2965263 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDS5IFI6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 2.10E-41, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|525829595|ref|YP_008252733.1| hypothetical protein CFSAN002069_19965 [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFTNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLGTESTPIHLEVYTRWEEGRWKIYRVRD
ADKGYEQPIYDAGAITQAEAWSAKVAPEYKKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|559996969|ref|NC_021812.2|:2964745-2965263 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCACGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTGGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACATCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGGTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGATAAGGGTTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCAA
AAGTCGCGCCGGAATATAAGAAGCATTAA