SecReT6
Immunity Protein ID: 525830372
SecReT6 ID821
T6SS typeA3
Gene symbol-
Locus tagCFSAN002069_07765
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
Repliconchromosome [GenBank: NC_021812] [Browse all T6SS(s) in this replicon]
Location [Strand]802360..802785 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTY0301
DescriptionTai2_TY
UniProt IDS5I6I7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|525830372|ref|YP_008250388.1| hypothetical protein CFSAN002069_07765 [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
MQKPILLLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPIISSAEGWNVSSRAARMLNDGGFLSSG
DPKEQADLKGEDAVVDGKKGRLWEIDPEDNRRGIWFSCSYGQWAVLLARKVQGTVATCWSPDVLPAKLIC
K
-
Nucleotide Sequence: 426 bp     [Download]
>gi|559996969|ref|NC_021812.2|:802360-802785 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069, complete genome
ATGCAGAAGCCTATTTTATTGTTGAATAGCACCTGTATTGTCGGGGGCATTCTGTGGTTACTTCCGGTAA
TAGTTGTTCATGCCGATGAGATTGTCTGCCCTGCGGTTATTCATTTTTCTCAGGCTCCAATAATTTCCTC
AGCGGAAGGATGGAATGTCTCATCCCGTGCAGCGCGTATGTTGAATGATGGTGGTTTTCTTTCGTCTGGC
GATCCCAAAGAGCAGGCAGATCTGAAAGGTGAAGATGCAGTCGTTGATGGGAAAAAGGGGCGTCTGTGGG
AGATAGACCCGGAGGATAATCGCCGGGGGATCTGGTTCTCATGTAGTTATGGACAGTGGGCTGTTCTGCT
TGCCAGAAAAGTTCAGGGAACGGTCGCGACATGCTGGAGCCCGGATGTCTTACCGGCAAAATTGATTTGT
AAATAA