SecReT6
Immunity Protein ID: 525837536
SecReT6 ID822
T6SS typeA3
Gene symbol-
Locus tagCFSAN001921_04905
StrainSalmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
Repliconchromosome [GenBank: NC_021814] [Browse all T6SS(s) in this replicon]
Location [Strand]1028269..1028787 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDS5HDQ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 1.60E-40, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|525837536|ref|YP_008254371.1| hypothetical protein CFSAN001921_04905 [Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFTNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRD
ADRGYEQPIYDAGAITQAEAWSAKVAPEYKKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|525836786|ref|NC_021814.1|:c1028787-1028269 Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCACGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTGGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGCTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGACAGGGGTTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCGA
AAGTCGCGCCGGAATATAAGAAGCATTAA