SecReT6
Immunity Protein ID: 526471048
SecReT6 ID834
T6SS typeA4b
Gene symbol-
Locus tagBDL_586
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]732637..733194 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityBTH_I2700
DescriptionBTH_I2700
UniProt IDS5NT97
KEGG IDbpse:BDL_586
PDB IDNA
Domain hit(s) vs Pfam DUF3304 [PF11745], Evalue: 1.50E-30, Aligned region: 10..140
Protein Sequence: 185 a.a.     [Download]
>gi|526471048|ref|YP_008340758.1| hypothetical protein BDL_586 [Burkholderia pseudomallei MSHR305]
MRGLALLGSVAACSRAVSEVSPQAGAKGAAVSQAGDDTMSLKLNALNDTDVPIGAFYVDGTWGSTVASRI
GSGGGQMICCASVPGKWHPGLTVTLRWQDGTLYKKDPDAMASRVVSVGKHEHFSDGFLWVLFFPNDRIKV
YASQWMPGFPGFPEGLQAPDSACPEHFTRLSDDPRCPHPDKRINL
-
Nucleotide Sequence: 558 bp     [Download]
>gi|526469930|ref|NC_021884.1|:c733194-732637 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGCGCGGGCTTGCGCTGCTGGGGAGTGTTGCGGCGTGCTCGCGGGCGGTGAGCGAAGTGTCGCCGCAGG
CGGGCGCGAAAGGCGCGGCGGTGTCGCAGGCGGGCGACGACACGATGAGTCTGAAGCTGAATGCGTTGAA
CGATACGGATGTGCCGATCGGCGCATTTTACGTAGACGGTACGTGGGGCAGTACTGTTGCGTCGCGCATA
GGTAGCGGTGGCGGACAAATGATCTGCTGTGCGTCTGTGCCGGGTAAGTGGCATCCCGGCTTGACTGTCA
CGTTGCGGTGGCAAGACGGCACGCTGTACAAGAAGGACCCGGACGCGATGGCGAGCCGGGTGGTTTCCGT
CGGGAAGCACGAGCATTTCTCCGACGGATTTCTATGGGTGCTGTTTTTTCCGAATGACAGGATCAAGGTG
TACGCATCGCAATGGATGCCCGGTTTTCCGGGGTTCCCGGAAGGGTTGCAGGCGCCGGACAGCGCGTGTC
CGGAGCACTTCACGCGTCTGAGCGACGATCCGCGCTGTCCCCATCCCGATAAGAGAATCAATTTATGA