SecReT6
Immunity Protein ID: 526471453
SecReT6 ID834
T6SS typeA4b
Gene symbol-
Locus tagBDL_1876
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2226674..2227042 [-]
Productputative lipoprotein
immunity typeProtein
Homologous immunityBTH_I0069
DescriptionTai2
UniProt IDS5NUD3
KEGG IDbpse:BDL_1876
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 122 a.a.     [Download]
>gi|526471453|ref|YP_008342029.1| putative lipoprotein [Burkholderia pseudomallei MSHR305]
MSWSKAACALFALSFLGCAGASGTAGSIDAGTQVCPVRAQSPLQYVDVFDGAPSDLATLIPDDAGERTGH
WELGYVYDAGRYVTIRCKYADGRTKDVRLAERVKRCDYRIDGKKTLQVTCAK
-
Nucleotide Sequence: 369 bp     [Download]
>gi|526469930|ref|NC_021884.1|:c2227042-2226674 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGTCGTGGAGTAAGGCCGCCTGCGCGCTGTTCGCCCTGTCGTTCCTCGGATGCGCGGGCGCATCCGGCA
CGGCGGGCTCGATCGACGCCGGCACGCAAGTGTGCCCGGTGCGGGCGCAAAGCCCGCTGCAATACGTCGA
CGTGTTTGACGGCGCGCCGAGCGATCTCGCGACGCTGATTCCCGACGACGCCGGCGAGCGCACAGGGCAT
TGGGAGCTCGGCTACGTGTACGACGCGGGGCGCTACGTGACGATCCGCTGCAAGTACGCGGACGGCCGGA
CCAAGGACGTCAGGCTCGCCGAGCGCGTGAAGCGCTGCGATTACCGGATCGACGGCAAGAAGACGCTGCA
GGTGACGTGCGCGAAGTGA