SecReT6
Immunity Protein ID: 549722996
SecReT6 ID857
T6SS typeA3
Gene symbol-
Locus tagSTMDT2_02741
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. DT2
Repliconchromosome [GenBank: NC_022544] [Browse all T6SS(s) in this replicon]
Location [Strand]318127..318510 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTM0278
DescriptionTai4_TM
UniProt IDU4M9D5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|549722996|ref|YP_008643186.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Typhimurium str. DT2]
MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYL
EYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
-
Nucleotide Sequence: 384 bp     [Download]
>gi|549722728|ref|NC_022544.1|:318127-318510 Salmonella enterica subsp. enterica serovar Typhimurium str. DT2, complete genome
GTGGATACTGCCGTGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCAT
CCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAATTGGGCGCTGAGTCA
TTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTT
GAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGA
AATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATTTTATCCATGACAGGGAATT
AAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA