SecReT6
Immunity Protein ID: 550901810
SecReT6 ID860
T6SS typeA3
Gene symbol-
Locus tagDT104_24321
StrainSalmonella enterica subsp. enterica serovar Typhimurium DT104
Repliconchromosome [GenBank: NC_022569] [Browse all T6SS(s) in this replicon]
Location [Strand]2554763..2555281 [+]
Productputative lipoprotein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDT2K825
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 1.60E-40, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|550901810|ref|YP_008670902.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT104]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFTNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRD
ADRGYEQPIYDAGAITQAEAWSAKVAPEYKKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|550899431|ref|NC_022569.1|:2554763-2555281 Salmonella enterica subsp. enterica serovar Typhimurium DT104 main chromosome, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCACGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTGGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGCTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGACAGGGGTTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCGA
AAGTCGCGCCGGAATATAAGAAGCATTAA