SecReT6
Immunity Protein ID: 558672801
SecReT6 ID874
T6SS typeA3
Gene symbol-
Locus tagPA1S_gp0492
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]610484..610768 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA0092
DescriptionTsi6
UniProt IDU6AI14
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 94 a.a.     [Download]
>gi|558672801|ref|YP_008809509.1| hypothetical protein PA1S_gp0492 [Pseudomonas aeruginosa PA1]
MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPE
LSRALKDAYYVGIRTGRGLKVDLP
-
Nucleotide Sequence: 285 bp     [Download]
>gi|558672313|ref|NC_022808.1|:610484-610768 Pseudomonas aeruginosa PA1, complete genome
ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGAT
ACGAGGTCCTGCTGTCCGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGA
TCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAA
CTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAAGTCGATCTGC
CCTGA