SecReT6
Immunity Protein ID: 558672820
SecReT6 ID874
T6SS typeA3
Gene symbol-
Locus tagPA1S_gp0511
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]632324..632557 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2703
DescriptionTsi2
UniProt IDU6A770
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 77 a.a.     [Download]
>gi|558672820|ref|YP_008809528.1| hypothetical protein PA1S_gp0511 [Pseudomonas aeruginosa PA1]
MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEQALGQYSGLPPYDR
LIEDPVS
-
Nucleotide Sequence: 234 bp     [Download]
>gi|558672313|ref|NC_022808.1|:632324-632557 Pseudomonas aeruginosa PA1, complete genome
ATGAACCTGAAACCCCAGACCCTGATGGTGGCGATCCAGTGCGTCGCCGCGCGCACCCGCGAACTCGACG
CGCAGTTGCAGAACGACGACCCGCAGAACGCCGCTGAACTCGAACAGTTGCTGGTCGGCTACGACCTCGC
CGCCGACGACCTGAAGAACGCCTACGAGCAAGCCCTGGGCCAATACAGCGGCCTGCCGCCCTATGACCGG
CTGATCGAAGACCCGGTGTCCTGA