SecReT6
Immunity Protein ID: 558672904
SecReT6 ID874
T6SS typeA3
Gene symbol-
Locus tagPA1S_gp0596
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]715698..716135 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2775
DescriptionTsi4
UniProt IDU6A719
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3592 [PF12158], Evalue: 1.70E-18, Aligned region: 9..131
Protein Sequence: 145 a.a.     [Download]
>gi|558672904|ref|YP_008809612.1| hypothetical protein PA1S_gp0596 [Pseudomonas aeruginosa PA1]
MTTSSGSRIGGLLHASLFSLLGLGLLLAGGFKTVERYHFLRTAQEAQGTVSALNAGGSHPQIDFTSVSGE
RISYPQGGFIFGYQVGEPVRVLYEAGRPAASAIVDDAGALWGTSAFLCGFGALFGIVGFRGLLGLRSSQP
TSKGH
-
Nucleotide Sequence: 438 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c716135-715698 Pseudomonas aeruginosa PA1, complete genome
ATGACGACCTCTTCCGGTTCGCGTATCGGCGGACTTCTTCACGCTTCCCTTTTTTCCCTGCTCGGACTCG
GTCTCCTGCTCGCCGGCGGTTTCAAGACCGTCGAGCGGTACCATTTCCTGCGTACTGCGCAGGAAGCCCA
GGGGACGGTCAGCGCCTTGAATGCCGGCGGTTCGCATCCGCAGATCGATTTCACCAGCGTTTCCGGCGAG
CGGATTTCCTATCCCCAGGGCGGCTTCATCTTCGGCTACCAGGTGGGCGAGCCGGTTCGCGTCCTCTACG
AGGCTGGGCGGCCGGCGGCCAGCGCGATAGTCGACGATGCCGGCGCGCTCTGGGGAACCAGCGCTTTCCT
CTGCGGCTTCGGCGCACTCTTCGGTATTGTCGGGTTCAGGGGATTGCTGGGCCTGCGTTCTTCCCAACCG
ACCTCAAAAGGACATTGA