SecReT6
Immunity Protein ID: 558673615
SecReT6 ID874
T6SS typeA3
Gene symbol-
Locus tagPA1S_gp1326
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]1490622..1491059 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3485
DescriptionTsi3
UniProt IDU6A9I0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|558673615|ref|YP_008810323.1| hypothetical protein PA1S_gp1326 [Pseudomonas aeruginosa PA1]
MKTVALILASLALLACTAESGVDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLRNPRQLEVQRQ
DAPPPPDLASRRLGDGEARYKVEEDDGGSAGSEYRLWAAKPAGARWIVVSASEQSEDGEPTFALAWALLE
RARLQ
-
Nucleotide Sequence: 438 bp     [Download]
>gi|558672313|ref|NC_022808.1|:1490622-1491059 Pseudomonas aeruginosa PA1, complete genome
ATGAAGACAGTCGCCCTGATTCTCGCCAGCCTCGCCCTGCTGGCCTGCACCGCGGAGTCCGGGGTGGACT
TCGACAAGACCCTGACCCACCCGAACGGCCTGGTGGTGGAGCGCCCCGTTGGCTTCGACGCGCGGCGCAG
CGCCGAGGGCTTCCGCTTCGACGAAGGCGGCAAGCTGCGCAACCCACGCCAACTGGAGGTCCAGCGCCAG
GACGCGCCGCCCCCGCCCGACCTGGCGAGCAGGCGCCTGGGCGACGGCGAGGCGCGCTACAAGGTAGAGG
AAGACGACGGCGGCTCCGCAGGCAGCGAATACCGCCTGTGGGCAGCCAAGCCGGCGGGCGCGCGGTGGAT
CGTGGTCAGCGCCAGCGAGCAGAGCGAGGATGGCGAACCGACCTTCGCCCTGGCCTGGGCGCTGCTGGAG
CGGGCCAGGTTGCAGTGA