SecReT6
Immunity Protein ID: 558677707
SecReT6 ID874
T6SS typeA3
Gene symbol-
Locus tagPA1S_gp5471
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]6069732..6070250 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA1845
DescriptionTsi1
UniProt IDU6ANS6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 172 a.a.     [Download]
>gi|558677707|ref|YP_008814415.1| hypothetical protein PA1S_gp5471 [Pseudomonas aeruginosa PA1]
MKLLAGSFAALFLSLSAQAADCTFTQLEIVPQFGSPNMFGGEDEHVRVMFSNEDPNDDNPDAFPEPPVYL
ADRDSGNDCRIEDGGIWSRGGVFLSQDGRRVLMHEFSGSSAELVSYDSATCKVVHREDISGQRWAVDKDG
LRLGEKCSGESVDSCAKIVTRSLAPFCQTAKK
-
Nucleotide Sequence: 519 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c6070250-6069732 Pseudomonas aeruginosa PA1, complete genome
ATGAAACTGCTCGCCGGCAGCTTCGCCGCTCTCTTCCTGAGCCTTTCGGCCCAGGCGGCGGACTGTACTT
TCACCCAGCTGGAAATCGTGCCCCAGTTCGGCTCGCCGAACATGTTTGGCGGCGAGGACGAGCACGTCCG
CGTGATGTTCAGCAACGAGGATCCCAACGACGACAACCCCGATGCCTTTCCCGAACCGCCGGTCTACCTG
GCCGACCGCGACAGCGGCAACGATTGCCGCATAGAGGACGGCGGCATCTGGTCGCGCGGCGGCGTGTTCC
TGAGCCAGGACGGCCGGCGCGTGCTGATGCATGAATTCAGCGGCTCCAGCGCCGAGCTGGTGTCCTACGA
CAGCGCCACCTGCAAGGTGGTGCACCGCGAGGACATCTCCGGCCAGCGCTGGGCGGTGGACAAGGACGGG
CTGCGCCTGGGAGAGAAATGCTCGGGCGAATCCGTCGACAGCTGCGCGAAGATCGTGACGCGTTCCCTCG
CGCCGTTCTGCCAGACCGCAAAGAAATGA