SecReT6
Immunity Protein ID: 560172777
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_0929
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]973746..974489 [+]
Productankyrin repeat-containing protein
immunity typeProtein
Homologous immunitySMDB11_0927 (Slp)
DescriptionImmune toxin SMDB11_0927(Slp,Secreted lipase-like protein) with SMDB11_0928
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 247 a.a.     [Download]
>gi|560172777|ref|CDG11506.1| ankyrin repeat-containing protein [Serratia marcescens subsp. marcescens Db11]
MRHSALIIIMLLSMLMMQGCEQGRDLQPQDYFEGKQLDIANVIYEGDRQKLDKVLPTVSKETLNRPAKAE
MTLLFWAINNAIFDKNTPERLKIITDLVKAGADPLQPRAEGGSSPAEFVMKANKGVWIQAMLEGGLSPNA
RDKVHNQPIIFESFDAANTETLKILIAYKADVNIKGAMNRTPLINALYNSCPEHIEVLLAHGANPLAKDD
FNDSFLSLISAEIDKGDKSNAYIKKLIKIKEKIKQVN
-
Nucleotide Sequence: 744 bp     [Download]
>gi|560171871|ref|HG326223.1|:973746-974489 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGAGGCACAGCGCTCTTATCATTATCATGTTGCTGTCAATGCTCATGATGCAGGGATGCGAACAAGGTA
GGGATCTACAACCACAGGATTACTTTGAAGGGAAGCAGCTGGACATCGCCAACGTCATCTACGAGGGTGA
CAGGCAAAAGCTGGATAAGGTTTTACCGACGGTAAGCAAAGAAACGTTAAATCGGCCGGCCAAGGCGGAG
ATGACGTTATTATTCTGGGCGATAAATAACGCTATCTTTGACAAGAACACGCCAGAGCGGCTCAAGATCA
TTACGGATCTGGTCAAGGCGGGAGCAGACCCACTGCAGCCAAGAGCTGAGGGGGGGAGTAGCCCCGCTGA
ATTTGTTATGAAGGCGAATAAAGGCGTATGGATACAAGCTATGTTAGAGGGCGGGCTCTCTCCAAATGCC
AGAGATAAGGTTCATAATCAACCCATTATATTTGAAAGTTTTGATGCGGCGAACACCGAAACATTAAAGA
TATTAATTGCATACAAAGCTGATGTTAATATCAAAGGGGCTATGAACAGAACGCCATTAATTAATGCGCT
GTATAACAGTTGCCCAGAACACATTGAGGTTCTTTTGGCTCATGGCGCTAACCCCTTAGCCAAAGATGAT
TTTAATGACAGCTTCCTCTCTCTGATTTCTGCGGAGATAGATAAAGGGGATAAGAGCAATGCGTATATAA
AAAAGCTAATTAAAATTAAAGAAAAAATAAAACAGGTGAATTAG

Reference
(1) Francesca R Cianfanelli, Juliana Alcoforado Diniz, Manman Guo, Virginia De Cesare, Matthias Trost, Sarah J Coulthurst (2016). VgrG and PAAR Proteins Define Distinct Versions of a Functional Type VI Secretion System. PLoS Pathog. 12(6):e1005735. [PudMed:27352036] experimental
 
experimental experimental literature