SecReT6
Immunity Protein ID: 560173454
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_1611
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]1693944..1694432 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySMDB11_1610 (Rhs2)
DescriptionRhsI2 is a direct immunity function for Rhs2
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 162 a.a.     [Download]
>gi|560173454|ref|CDG12185.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MNEFDFDSLLQRIDSSCFFSRMGLPDVLDSRVILIENVEKVFVNPTDAEFKGYYDSVEWLPTSMTQEDPF
YKVKEVLPKELTGLRIRVNKAVMNATKGLSKDKFNYGPHDFSLAARNGICFAFREYVSEQYLHLGNKWEE
VVGIYFSGHWPVGIAKDKIVTI
-
Nucleotide Sequence: 489 bp     [Download]
>gi|560171871|ref|HG326223.1|:1693944-1694432 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGAATGAATTTGACTTTGATAGTTTACTACAGCGCATCGATAGCTCATGCTTTTTCTCAAGAATGGGGC
TCCCAGATGTTCTGGATAGTCGCGTGATTTTAATTGAAAATGTTGAGAAGGTGTTTGTTAATCCCACTGA
TGCAGAGTTTAAGGGATACTATGATAGTGTGGAATGGTTGCCAACATCAATGACTCAGGAGGATCCTTTC
TACAAAGTAAAGGAGGTATTACCTAAGGAACTTACTGGTTTACGTATTCGAGTAAACAAGGCTGTCATGA
ATGCAACAAAGGGATTGTCTAAGGATAAATTCAATTACGGGCCTCATGACTTCAGCTTAGCAGCCAGAAA
TGGAATTTGTTTTGCGTTCAGAGAGTATGTTTCTGAACAGTATCTTCATTTAGGGAATAAGTGGGAAGAA
GTTGTGGGTATATACTTTTCTGGTCACTGGCCTGTGGGTATAGCAAAAGATAAGATAGTTACCATTTAA

Reference
(1) Diniz JA et al. (2015). Intra-species Competition in Serratia marcescens is Mediated by Type VI Secretion Rhs Effectors and a Conserved Effector-Associated Accessory Protein. J Bacteriol. pii: JB.00199-15. [PudMed:25939831] experimental
 
experimental experimental literature