SecReT6
Immunity Protein ID: 568152668
SecReT6 ID887
T6SS typeA3
Gene symbol-
Locus tagT223_07605
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]1616162..1616605 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3485
DescriptionTsi3
UniProt IDV9T2P3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 147 a.a.     [Download]
>gi|568152668|ref|YP_008941621.1| hypothetical protein T223_07605 [Pseudomonas aeruginosa LES431]
MKTVALILASLALLACTAESGVDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLRNPRQLEVQRQ
DAPPPPDLASRRLGDGEARYKVEVEEDDGGSAGSEYRLWAAKPAGTRWIVVSASEQSEDGEPTFALAWAL
LERARLQ
-
Nucleotide Sequence: 444 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c1616605-1616162 Pseudomonas aeruginosa LES431, complete genome
ATGAAGACAGTCGCCCTGATTCTCGCCAGCCTCGCCCTGCTGGCCTGCACCGCGGAGTCCGGGGTGGACT
TCGACAAGACCCTGACCCACCCGAACGGCCTGGTGGTGGAGCGCCCCGTCGGCTTCGACGCGCGGCGCAG
CGCCGAGGGCTTCCGCTTCGACGAAGGCGGCAAGCTGCGCAACCCACGCCAACTGGAGGTCCAGCGCCAG
GACGCGCCGCCCCCGCCCGACCTGGCGAGCAGGCGCCTGGGCGACGGCGAGGCGCGCTACAAGGTAGAGG
TAGAGGAAGACGACGGCGGCTCCGCAGGCAGCGAATACCGCCTGTGGGCAGCCAAGCCGGCGGGCACGCG
GTGGATCGTGGTCAGCGCCAGCGAGCAGAGCGAGGATGGCGAACCGACCTTCGCCCTGGCCTGGGCGCTG
CTGGAGCGGGCCAGGTTGCAGTGA