SecReT6
Immunity Protein ID: 568153441
SecReT6 ID887
T6SS typeA3
Gene symbol-
Locus tagT223_11635
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]2428191..2428628 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2775
DescriptionTsi4
UniProt IDV9T445
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3592 [PF12158], Evalue: 1.70E-18, Aligned region: 9..131
Protein Sequence: 145 a.a.     [Download]
>gi|568153441|ref|YP_008942402.1| hypothetical protein T223_11635 [Pseudomonas aeruginosa LES431]
MTTSSGSRIGGLLHASLFSLLGLGLLLAGGFKTVERYHFLRTAQEAQGTVSALNAGGSHPQIDFTSVSGE
RISYPQGGFIFGYQVGEPVRVLYEAGRPAASAIVDDAGALWGTSAFLCGFGALFGIVGFRGLLGLRSSQP
TSKGH
-
Nucleotide Sequence: 438 bp     [Download]
>gi|568151185|ref|NC_023066.1|:2428191-2428628 Pseudomonas aeruginosa LES431, complete genome
ATGACGACCTCTTCCGGTTCGCGTATCGGCGGACTTCTTCACGCTTCCCTTTTTTCCCTGCTCGGACTCG
GTCTCCTGCTCGCCGGCGGTTTCAAGACCGTCGAGCGGTACCATTTCCTGCGTACTGCGCAGGAAGCCCA
GGGGACGGTCAGCGCCTTGAATGCCGGCGGTTCGCATCCGCAGATCGATTTCACCAGCGTTTCCGGCGAG
CGGATTTCCTATCCCCAGGGCGGCTTCATCTTCGGCTACCAGGTGGGCGAGCCGGTTCGCGTCCTCTACG
AGGCTGGGCGGCCGGCGGCCAGCGCGATAGTCGACGATGCCGGCGCGCTCTGGGGAACCAGCGCTTTCCT
CTGCGGCTTCGGCGCACTCTTCGGTATTGTCGGGTTCAGGGGATTGCTGGGCCTGCGTTCTTCCCAACCG
ACCTCAAAAGGACATTGA