SecReT6
Immunity Protein ID: 568153548
SecReT6 ID887
T6SS typeA3
Gene symbol-
Locus tagT223_12225
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]2537061..2537294 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2703
DescriptionTsi2
UniProt IDV9T574
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 77 a.a.     [Download]
>gi|568153548|ref|YP_008942518.1| hypothetical protein T223_12225 [Pseudomonas aeruginosa LES431]
MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEQALGQYSGLPPYDR
LIEEPAS
-
Nucleotide Sequence: 234 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c2537294-2537061 Pseudomonas aeruginosa LES431, complete genome
ATGAACCTGAAACCCCAGACCCTGATGGTGGCGATCCAGTGCGTCGCCGCGCGCACCCGCGAACTCGACG
CGCAGTTGCAGAACGACGACCCGCAGAACGCCGCTGAACTCGAACAGTTGCTGGTCGGCTACGACCTCGC
CGCCGACGACCTGAAGAACGCCTACGAGCAAGCCCTGGGCCAATACAGCGGCCTGCCGCCCTATGACCGG
CTGATCGAAGAGCCGGCATCCTGA