SecReT6
Immunity Protein ID: 568153568
SecReT6 ID887
T6SS typeA3
Gene symbol-
Locus tagT223_12325
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]2562881..2563072 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityTsi5
DescriptionTsi5
UniProt IDV9T593
KEGG IDpael:T223_12325
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 63 a.a.     [Download]
>gi|568153568|ref|YP_008942538.1| hypothetical protein T223_12325 [Pseudomonas aeruginosa LES431]
MIKHYLLMTLVCIPLALLYVCLEWFFGNTWVTVGVFFGVLVVLRLGLYLYRRSKGIRDGYLDE
-
Nucleotide Sequence: 192 bp     [Download]
>gi|568151185|ref|NC_023066.1|:2562881-2563072 Pseudomonas aeruginosa LES431, complete genome
ATGATCAAGCATTACCTGCTGATGACCCTCGTCTGCATACCGCTGGCGTTGCTCTACGTCTGCCTGGAAT
GGTTCTTCGGCAACACCTGGGTGACCGTCGGGGTGTTCTTCGGCGTGCTCGTCGTGCTGCGCCTCGGGCT
CTACCTCTACCGCCGCTCGAAGGGCATCAGGGACGGCTACCTGGACGAGTGA