SecReT6
Immunity Protein ID: 568154626
SecReT6 ID887
T6SS typeA3
Gene symbol-
Locus tagT223_17780
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]3810416..3810934 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA1845
DescriptionTsi1
UniProt IDV9T7C7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 172 a.a.     [Download]
>gi|568154626|ref|YP_008943608.1| hypothetical protein T223_17780 [Pseudomonas aeruginosa LES431]
MKLLAGSFAALFLSLSAQAADCTFTQLEIVPQFGSPNMFGGEDEHVRVMFSNEDPNDDNPDAFPEPPVYL
ADRDSGNDCRIEDGGIWSRGGVFLSQDGRRVLMHEFSGSSAELVSYDSATCKVVHREDISGQRWAVDKDG
LRLGEKCSGESVDSCAKIVKRSLAPFCQTAKK
-
Nucleotide Sequence: 519 bp     [Download]
>gi|568151185|ref|NC_023066.1|:3810416-3810934 Pseudomonas aeruginosa LES431, complete genome
ATGAAACTGCTCGCCGGCAGCTTCGCCGCTCTCTTCCTGAGCCTTTCGGCCCAGGCGGCGGACTGTACTT
TCACCCAGCTGGAAATCGTGCCCCAGTTCGGCTCGCCGAACATGTTCGGCGGCGAGGACGAGCACGTCCG
CGTGATGTTCAGCAACGAGGATCCCAACGACGACAACCCCGATGCCTTTCCCGAACCGCCGGTCTACCTG
GCCGACCGCGACAGCGGCAACGATTGCCGCATAGAGGACGGCGGCATCTGGTCGCGCGGCGGCGTGTTCC
TGAGCCAGGACGGCCGGCGCGTGCTGATGCATGAATTCAGCGGCTCCAGCGCCGAGCTGGTGTCCTACGA
CAGCGCCACCTGCAAGGTGGTGCACCGCGAGGACATCTCCGGCCAGCGCTGGGCGGTGGACAAGGACGGG
CTGCGCCTGGGTGAGAAATGCTCGGGCGAATCCGTCGACAGCTGCGCGAAGATCGTGAAGCGTTCGCTCG
CGCCGTTCTGCCAGACCGCAAAGAAATGA