SecReT6
Immunity Protein ID: 83718861
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I2700
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3092232..3092810 [-]
Productlipoprotein
immunity typeProtein
Homologous immunityBTH_I2700
DescriptionBTH_I2700
UniProt IDQ2SV34
KEGG IDbte:BTH_I2700
PDB IDNA
Domain hit(s) vs Pfam DUF3304 [PF11745], Evalue: 5.30E-33, Aligned region: 17..147
Protein Sequence: 192 a.a.     [Download]
>gi|83718861|ref|YP_443215.1| lipoprotein [Burkholderia thailandensis E264]
METIVRSMCLLALPGSVAACSRAMSDVSSRAGGKGAAVSQAGDDTMSLKLNALNYTDVPIGVFYVDGTWG
STVPSRIGSGGGQIICCVSLPSKWHPGLTVTLRWQDDTLYKKDPDAMASRVVSVEKCDHFSDGFLWVVLF
PNDRIKVYASQWMPGFPGFPEGLQAPDSVCPEHFTRLNDGPRCPHPDKRIKS
-
Nucleotide Sequence: 579 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3092810-3092232 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGGAAACGATTGTTCGGTCGATGTGCTTGCTTGCGCTGCCGGGCAGTGTTGCGGCGTGCTCGCGTGCGA
TGAGCGATGTGTCGTCGCGGGCGGGCGGGAAAGGCGCGGCGGTGTCGCAGGCGGGCGACGACACGATGAG
TCTGAAGCTGAATGCGTTGAACTACACGGATGTGCCGATCGGCGTGTTTTACGTAGACGGTACGTGGGGC
AGTACTGTTCCGTCGCGTATAGGTAGCGGTGGAGGGCAAATTATCTGCTGCGTGTCTCTGCCAAGTAAGT
GGCATCCCGGCCTGACTGTAACGTTGCGGTGGCAAGACGACACGCTGTACAAGAAGGACCCGGACGCGAT
GGCGAGCCGGGTGGTTTCCGTCGAGAAGTGCGACCATTTCTCCGACGGATTTCTATGGGTGGTGTTGTTC
CCGAATGACAGGATCAAGGTGTACGCATCGCAATGGATGCCCGGTTTTCCTGGGTTCCCGGAAGGGCTGC
AGGCGCCGGATAGCGTGTGTCCGGAGCATTTCACGCGGCTGAACGACGGCCCACGCTGCCCTCATCCCGA
TAAGAGAATCAAGTCATGA