SecReT6
Immunity Protein ID: 83719910
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I0069
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]74394..74789 [+]
Productlipoprotein
immunity typeProtein
Homologous immunityBTH_I0069 (Tai2)
DescriptionTai2
UniProt IDQ2T2K6
KEGG IDbte:BTH_I0069
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 131 a.a.     [Download]
>gi|83719910|ref|YP_440629.1| lipoprotein [Burkholderia thailandensis E264]
MSWSKAACALAAASFFGCAGASGTADATGATGAAGAARAGTAVCPVRAQSPLQYVDVFDGAPSDLATLIP
DDAGERKGHWELGYVYDAGRYVTIRCKYADGQTKDVRLAERVNRCDYRIDGKKTLKVTCRK
-
Nucleotide Sequence: 396 bp     [Download]
>gi|83718394|ref|NC_007651.1|:74394-74789 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGTCGTGGAGTAAGGCCGCCTGCGCACTCGCCGCCGCGTCGTTCTTCGGATGCGCGGGCGCGTCGGGCA
CGGCGGACGCGACCGGTGCGACCGGTGCGGCCGGCGCAGCCCGTGCGGGCACGGCAGTCTGCCCGGTGCG
GGCGCAAAGCCCGCTGCAATACGTCGACGTATTCGACGGCGCGCCGAGCGATCTCGCGACGCTGATTCCC
GACGACGCCGGCGAGCGCAAGGGGCATTGGGAGCTGGGCTACGTGTACGACGCGGGACGCTACGTGACGA
TCCGCTGCAAGTACGCGGACGGCCAGACGAAGGACGTCAGGCTCGCCGAGCGCGTGAATCGCTGCGATTA
CCGGATCGACGGCAAGAAGACGCTGAAGGTGACGTGCAGGAAATGA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature