SecReT6
Immunity Protein ID: 83720303
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I2703
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3095918..3096661 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityBTH_I2700
DescriptionBTH_I2700
UniProt IDQ2SV31
KEGG IDbte:BTH_I2703
PDB IDNA
Domain hit(s) vs Pfam DUF3304 [PF11745], Evalue: 3.60E-32, Aligned region: 72..202
Protein Sequence: 247 a.a.     [Download]
>gi|83720303|ref|YP_443218.1| hypothetical protein BTH_I2703 [Burkholderia thailandensis E264]
MRSRRRDGSCLPKCRLRRGGRIMTCGERWGWRGTVPSSMRSRIPRLTLIVLGRRTMETIVRSMCLLALPG
SVAACSRAMSDVSSRAGGKGAAVSQAGDDTMSLKLNALNYTDVPIGVFYVDGTWGSTVPSRIGSGGGQII
CCVSLPSKWHPGLTVTLRWQDDTLYKKDPDAMASRVVSVKKCDHFSDGFLWVVLFPNDRIKVYASQWMPG
FPGFPEGLQAPDSACPDHFTLLSDDPRCPHPDKRIKS
-
Nucleotide Sequence: 744 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3096661-3095918 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGCGCTCGAGGCGGCGGGATGGCTCGTGCCTGCCGAAGTGTCGGCTTAGGCGGGGCGGGCGGATCATGA
CGTGCGGCGAAAGGTGGGGATGGCGTGGGACGGTGCCGTCGTCCATGCGATCCCGGATTCCGCGTTTGAC
GCTGATCGTGCTTGGGCGTCGGACGATGGAAACGATTGTTCGGTCGATGTGCTTGCTTGCGCTGCCGGGC
AGTGTTGCGGCGTGCTCGCGTGCGATGAGCGATGTGTCGTCGCGGGCGGGCGGGAAAGGCGCGGCGGTGT
CGCAGGCGGGCGACGACACGATGAGTCTGAAGCTGAATGCGTTGAACTACACGGATGTGCCGATCGGCGT
GTTTTACGTAGACGGTACGTGGGGCAGTACTGTTCCGTCGCGTATAGGTAGCGGTGGAGGGCAAATTATC
TGCTGCGTGTCTCTGCCAAGTAAGTGGCATCCCGGCCTGACTGTAACGTTGCGGTGGCAAGACGACACGC
TGTACAAGAAGGACCCGGACGCGATGGCGAGCCGGGTGGTTTCCGTCAAGAAGTGCGACCATTTCTCCGA
CGGATTTCTATGGGTGGTGTTGTTCCCGAATGACAGGATCAAGGTGTACGCATCGCAATGGATGCCCGGA
TTTCCGGGGTTCCCGGAAGGGCTGCAGGCGCCGGATAGCGCGTGTCCGGATCACTTCACGTTGCTGAGCG
ACGATCCGCGCTGTCCCCATCCCGATAAGAGAATCAAGTCATGA