SecReT6
Immunity Protein ID: 83720426
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I2699
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3091636..3092235 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityBTH_I2699 (Tli1)
DescriptionTli1
UniProt IDQ2SV35
KEGG IDbte:BTH_I2699
PDB IDNA
Domain hit(s) vs Pfam DUF3304 [PF11745], Evalue: 3.00E-36, Aligned region: 25..154
Protein Sequence: 199 a.a.     [Download]
>gi|83720426|ref|YP_443214.1| hypothetical protein BTH_I2699 [Burkholderia thailandensis E264]
MNLHFGSMKIFIRLAVFLMVFLVSTGCSRAIDHSSENAIAGNESVAQSGDDMMSLKLDALNYTDIPVGTF
YVDGVWGGNVFSRIGSGGGGITCCVSLPKKWHPGLSVTVEWRNDEMYKKNPESVASRTVPVEKYGEFTGG
YLWVLFFPGEGIKVYATPWLPGAADFPEGLQAPSEACPGDFTLLNSDSRCKNPDKRIKP
-
Nucleotide Sequence: 600 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3092235-3091636 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGAATTTGCATTTCGGCTCGATGAAGATTTTTATCAGACTGGCGGTATTTCTGATGGTGTTTCTTGTGA
GCACAGGTTGTTCGCGCGCGATAGATCATTCGTCCGAGAATGCCATCGCGGGAAATGAGTCGGTTGCGCA
GTCGGGCGACGACATGATGAGTTTGAAGCTGGATGCGCTCAATTATACGGACATACCTGTTGGAACTTTT
TACGTTGATGGCGTATGGGGTGGTAACGTGTTTTCCCGGATCGGAAGTGGTGGCGGGGGCATCACCTGCT
GTGTGTCTTTGCCAAAAAAGTGGCATCCGGGGCTTAGTGTCACGGTGGAGTGGCGTAACGACGAGATGTA
TAAGAAAAACCCGGAATCGGTGGCTAGTAGAACTGTGCCAGTGGAAAAATACGGCGAATTTACGGGCGGA
TACCTGTGGGTTCTGTTCTTCCCGGGTGAAGGAATCAAGGTATATGCAACACCGTGGCTTCCGGGGGCTG
CAGACTTTCCCGAGGGGCTGCAAGCGCCAAGTGAGGCATGTCCAGGAGATTTTACCTTGCTGAACAGTGA
TTCACGATGCAAGAATCCTGACAAAAGGATCAAGCCATGA

Reference
(1) Russell AB et al. (2013). Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 496(7446):508-12. [PudMed:23552891] experimental
 
experimental experimental literature