Home 

Gene Symbol:  
nocD
Organism:  
Nocardia sp. ATCC 202099
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
25968..26960 [-1], 993 bp
Product Function:  
dehydratase
Product Locus:  
 ADR01080.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:993 bp
>nocD|ThioFinder132 Nocardia sp. ATCC 202099
ATGTGGCGGGCGCTGCACGTGCACCGCTACGCCGACCAGGACACCCTGATCACCGACGGGATAGCGCCCG
TGCTGGAGCTGCTGCGCGAGTCCGGCGCGATCCACGGGTGGTTCTTCCTGCGCTACTGGCAGGGCGGGCA
CCACATCCGGGTGCGGATGCGGGTCGCCGAGACCGACGCCGACGCGGTCGTCGGGGAGGTCGATGGCAAG
CTGCGCGCCTACCTGGCCGAGCACCCGGCGGCCGAGCAGTTCGACGCCGAGGAGTTCCACCGCGAGGCGC
AGCCGACGATGGCGGCGCTGGAGGGCACCGCCGCCGAGGAGATCCACCCGCCGGACAGCGTCCGCCGCGT
CGAGTACGCCCCCGAGCACGACAAGTACGGCGGGCCGGACGGCGTGGCTGTCGCCGAGGACTACTTCGGC
GACAGCAGCGCCATCGTGGTCGACGCGCTGCGCGCGGTCGGCGGCAAGTCGAGCAAGCGCACCGGCATGG
GCTACGGCATGATGCTGCGCGGCCTGTGCGCCACCGACCTGACGCCCGCCGAGATGGCCGCGTTCTTCGC
CCACTACTGCGTGATCTGGTCGCCGTACGTCTTCGACGGCTTCCTCGACGCCTGGCCTGCCCTGCTCGCC
GAGCACTCGGCTCCGCTGCGCGCGCACACCGAGGCCGTCCTGGCCAACCGGGGCGCGCTCGCGGGCGACC
CGATGCACGACGCCGTGGGCCGCGCGTGGGCCAGGGTGCACGAGGCCGGTCCCGCGGTGCTGGACCGGGT
GAGGCTGGCGGGCGATGACGCGTCCGCGGCCCGGCGCGCGCAGGTGCTGCTCGTGTCCTACCTGCACACG
CACAACAACCGCTTTGGCCTCATCCCGGAGCTGGAGGCGTTCCTGGGGTACCTGGGCCACCACGTGCTGA
GCGGGTGCGCTGGCACGCCCGTCGACGCGGGCCTGGAATCCCGCGTCCGCTCGCACCGCGCGCAGCTGAT
CGGCACGCCATGA
 Primer design

Protein Sequence:330 a.a.
>NocD|ThioFinder132 Nocardia sp. ATCC 202099
MWRALHVHRYADQDTLITDGIAPVLELLRESGAIHGWFFLRYWQGGHHIRVRMRVAETDADAVVGEVDGK
LRAYLAEHPAAEQFDAEEFHREAQPTMAALEGTAAEEIHPPDSVRRVEYAPEHDKYGGPDGVAVAEDYFG
DSSAIVVDALRAVGGKSSKRTGMGYGMMLRGLCATDLTPAEMAAFFAHYCVIWSPYVFDGFLDAWPALLA
EHSAPLRAHTEAVLANRGALAGDPMHDAVGRAWARVHEAGPAVLDRVRLAGDDASAARRAQVLLVSYLHT
HNNRFGLIPELEAFLGYLGHHVLSGCAGTPVDAGLESRVRSHRAQLIGTP