Home 

Gene Symbol:  
nocE
Organism:  
Nocardia sp. ATCC 202099
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
26965..29523 [-1], 2559 bp
Product Function:  
dehydratase
Product Locus:  
 ADR01081.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2559 bp
>nocE|ThioFinder133 Nocardia sp. ATCC 202099
TCACCGGGCATCGCAACCTCCGGTAAGGGTGTGCTCGACGAAGAACTCCTCGGCGCTCCCGGCGCCGGAG
GCGTAGCCCTCAGCTCCGGGGAGGCATTCCTGCACGACGACGTGACCGCCGGGGGTGGCGCGGGCCTGCT
TGGCCAGCACGTGCAGCAGGAACGGGTTGGCCGCGTCGAGGTAGTGCGGCTTGTGCAGCCGGGCGCTGCG
CGCCTGCAGCGCCCACTCGCGGGTCTCGGCGGCGTAGTCGCGCTCGCCGTCGGCGCGCACCGGCGGGGCG
ACGACCCGGAAGAACGCGTGCCGGGGCAGCCCGGCCGCGCGCCGCCACGCGTCGAACTCGGCCAGCGCGG
TCAGCTCCTGGCGCTCCAGCCCGTCCAGCGCGGGCAGGTCGGCCACCGGCAGCCGCCACGAGCGGCGGTC
CAGCACCAGCCCGCCGAGCCGCACCCTCGGCCGGTCGGCCGGGGCGAGCCCGGCGCGGTCGAGCTGGTCC
CACAGCCCGCCCCGGTAGGTGCGGGTGGGCGCGAACGCGCAGAGGAACCGGTAGAGCATCGGCGCGGCGG
CCGGGTACAGGAAGTTCAGCGGGGCCAGGTCGATCCGCTCACCGTCCTGTGTGGACCACAGGGCCAGGCG
GCGGGTGGTCGGGTCGGCGCGGACGACGAGGTCGGCCAGGGTCAGCACGCCGGTCGCGCCGGGGCGCTGC
ACCGAGCCGGGGTAGACGACCTCCAGCGGGGTCAGCCTCGGGTGCAGGTTGAAGTTCAGGCCGAGCGCGG
CGGTGATGTCGGCCTGCCTCGGCGTGTGCCTGGCGATCGTGTCGCGCAGCGACCCGGCCAGGTCGAACCG
ACCGCCACCCAGCAGATCGCAGTAGCGGGAAAAGAAGACTCCGTGCCCGGTGGTGATGCCGTTGACCACG
GTGAGGTCGTCGGCCTGCTGCACCCGGTAGGCGGTGGAGCGCCACGGCACGACCGTCGGCGGCAGCGCGT
CGACCACCGAGGCCAGATGCGCCGGGTCGAGCACCAGTTCGCCGTCGGCGCGCTGGTCGCGGACCCAGCC
GAGGAAGTCGCGGCGCAGGGCCAGCACGTGCTGGGCGTGCGGGTCGCCGACACCGCACATCACCGCGCTC
GCCTCGGCGGGCGAGAGCGCGGAGAACGCCTCGTACAGCTCCACGACAGGAACACCCGCGTGGTCCTCGC
CGAAGCGGTCGGCGAAGAACGCGTACAGGCCCAGCTTCTCCACGATGGCGTCGTCCAGCAGCGGCACCAG
GCGCTGGAGCAGGTCCAGGTTCTCCCGGTCGCGCTCCAGCAGCGCGGGCCGCCAGCTGTCGGCGTGCGCG
CGGGTGCCGACGTCCTCGTACAGCGCGGCGCGCATGGCCTCGCGGGCGGGCGGCGGGCAGCCGACGACCT
CCACGAACCGGGCCACCAGCGCGCGCAGCTCGGCCAGCAGCCCGGTGCGCCGCGCGGCGGGCGCGTCGGC
GAAGGCGTCCTCGACGGCTTGCAGGCCGGTGAACACCTCGGCGCAGGCCAGCGCCTGCGCGGTGCCCACG
GCCGCCAGCCTGCTGGCGACCTCCTCGGCGACCCGGTCGGCCTGGTCGGGCAGGCCGAGGCCGCGGTGGC
ACAGCCCGGCGCGGACGAGCTGGTCGATGGTGCCAGCCGCGGCGTCGGCGGCCAGCCCGGCGTCGACGAG
CCGGGCGCGCAGGTCGTCCTCGGTGCGGTCGTGGTCGGCGAGCAGACCGACGAGCACCCGCACCAGCGGC
GAGTTCTTGGCCCGGATCACCTGGTCGGGCCGGAACCCGTCGTCGGCGCCCTCCAGCGGCCTGCGCACGG
AGACGGCGTGCTCGCCGCGCACGGCGAGGGAGTTGTTGAGCCGCACCCGCAGCAGCGCACCCGCGCCGTC
GACCCGGTGCAGCTGGTGGGTCATCCAGGCGAGCAGGCCGACGCTGAGCCGCGCCCGCGCGACCCGCTCC
CCCGCCGCGGGCGCCGCCCCCCAGGGCTGGGCCCCGATCTCGGTGAACGCGCCGAACGGCGAGGGCTTGA
AGACGACGCGGTAGGCGAAGCTGGTGATCGTGCTCTCCGCCCTGCGCCGCTTGGCAGGCTTGCGGGTGGT
GTCGAACGGGTCGCCCGCGTACGCGGTGACCTCCCGGTGCACGTCCTCGCCGGAGAGCTGCACGCCGCGC
TGGAAGTCCTCGCCGAGGGCGACGGCGGCCAGCGCCTTGCGCGCGCTCTCCAGCTCGGCGGCGTAGACCT
CCTCGGCCAGCGCCTCCAGCTCCGCGCCGCGCCTGCGCGCCGCGACCCACTCGCCGACCCGCTCGGCGAG
GTCGCCGGGCAGCGGCGGAACCGACGCGGGAACGCGGTCGTTGTGCACGTCGCGGCGCAGCTTCAGCACG
GCCCTGCGCTCGGCGTCGGCCACCTCGGGGACGACGGCGTGCAGGGCGTCGGACAGGCGGGCGCGCAGCG
GCTCGCGGACGGCGCGCTCGGCGTCGGCGGCGGCCAGCAGCTCCCAGGTGCGCGTCGGCACCAGGCCCGC
CAGCGCGGGCAGGCCGATGGTGCCGCGCCGGAACAGCAT
 Primer design

Protein Sequence:852 a.a.
>NocE|ThioFinder133 Nocardia sp. ATCC 202099
MLFRRGTIGLPALAGLVPTRTWELLAAADAERAVREPLRARLSDALHAVVPEVADAERRAVLKLRRDVHN
DRVPASVPPLPGDLAERVGEWVAARRRGAELEALAEEVYAAELESARKALAAVALGEDFQRGVQLSGEDV
HREVTAYAGDPFDTTRKPAKRRRAESTITSFAYRVVFKPSPFGAFTEIGAQPWGAAPAAGERVARARLSV
GLLAWMTHQLHRVDGAGALLRVRLNNSLAVRGEHAVSVRRPLEGADDGFRPDQVIRAKNSPLVRVLVGLL
ADHDRTEDDLRARLVDAGLAADAAAGTIDQLVRAGLCHRGLGLPDQADRVAEEVASRLAAVGTAQALACA
EVFTGLQAVEDAFADAPAARRTGLLAELRALVARFVEVVGCPPPAREAMRAALYEDVGTRAHADSWRPAL
LERDRENLDLLQRLVPLLDDAIVEKLGLYAFFADRFGEDHAGVPVVELYEAFSALSPAEASAVMCGVGDP
HAQHVLALRRDFLGWVRDQRADGELVLDPAHLASVVDALPPTVVPWRSTAYRVQQADDLTVVNGITTGHG
VFFSRYCDLLGGGRFDLAGSLRDTIARHTPRQADITAALGLNFNLHPRLTPLEVVYPGSVQRPGATGVLT
LADLVVRADPTTRRLALWSTQDGERIDLAPLNFLYPAAAPMLYRFLCAFAPTRTYRGGLWDQLDRAGLAP
ADRPRVRLGGLVLDRRSWRLPVADLPALDGLERQELTALAEFDAWRRAAGLPRHAFFRVVAPPVRADGER
DYAAETREWALQARSARLHKPHYLDAANPFLLHVLAKQARATPGGHVVVQECLPGAEGYASGAGSAEEFF
VEHTLTGGCDAR