Home 

Gene Symbol:  
nocF
Organism:  
Nocardia sp. ATCC 202099
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
29544..30983 [-1], 1440 bp
Product Function:  
dehydrogenase
Product Locus:  
 ADR01082.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1440 bp
>nocF|ThioFinder134 Nocardia sp. ATCC 202099
ATGACCGGCGACCTCGCCGAGCACACCGAGTCGCTGCGCCGCGACCCGCAGGGCGCCAACCCCGACGGCT
GGCGCGTCGACTGGGCCGACGGACCGTGGCCGGTCAAGGTCTACGCGGGCGGCGTACGCACCCCGCTTGG
CCGCGCGGGCGCGCTGGACCGGCTGCTGCTGTTCACCTTCGGCATGACCGCCGTCCGGTTCGACCCGGCG
GGCGGCATGCCGTCCACACCGGACAACCCGACGCCGACGCACCTGGGGGAGCGCTACGCCCCGCGCAGGC
CGATCCCGTCCGGCGGGTCGATGTACCCGACCGAGGCGTACGTCGTGGACACCGAAGCGGGCCGGGTCAG
CCACTACGACCCGTACCGGCACGAGCTGGTCGACCTGGGCCGCCCCGCGCCCCGCGCCGCGCTGCGGGCC
GCGCTCGGCGAGCCCGCCGACGCCCCGCTGCCCCCGGCCGTGCTGCTGGTGGCCAACCGGTTCTGGAAGA
ACGCCTACAAGTACGGCGAGTTCGCCGCCCGGCTCGGCGCGGTGGACACCGGGGTCGCGCTGGGCCGGGC
GGCCCGCGTCGCCGAGGCGGCCTTCGGCGACATCGCCGTCCTGGTCGACCTGGACGCCGCGGCGGTCGAG
GACCTGCTCGGCCTCGACGGGCGCGACGAGGCCGTGTTCGCGGCGGTCGAGCTGGGGCGTCGGCGGGACT
GCCCGGCCGAGCCGCCCGCCGAGCGCGCCGCGCCGCCCCCGGTGCTGGAGCGCTCGCGCGCTGTCCGGCG
GCTGCCCGGCCTGAGCGCGCTGACCGAGGCCGCCCGCCAGCCCGCCGAGCCGGTGGCCGTCGACCGGCCC
GCCGCCGTGCGCGGACCGCTGGACCTGCTGGACCCCGGCGTCATGGTGCGCCGGGGCTCGCACGGCCGCC
GGTTCACCGGAGCCCCGGTGCGGCTGGCCGACGTCGAGGCCGTCCTGCTGCACGCGGCAGAGGCGGCGGC
CCGGCTGGCGGCGGTCTCCGGCGGCGCGGTCGGCGCGGAGGCCGGGCTGTGCTGCGCCGTGCGCCGCGTC
GAGGGGCTGGCCCCCGGCTGGTACCGCTTCGACGGCGCGCTCGTCCCGGTCGCCGAGGACGACCCCGGCC
CGGTGCTGCGGCGCGCGCTGTTCGCCGAGTCGCTCAACCCGGAGCTGGCCGCGTTCACCGTCCACGTCAC
CGGCCCCGTCGACTTCGCGGGCGGCGCCGCGGGATACCGCGCCCGCCAGCTCGGCGTCGGCGCGGTGGTG
GAGGCGGTGTGCCTGGCCGCCACCGCGGCGCGGCTCAGCGGCCACGCCGTCCTGGGCTTCGACGTCGGCC
CGATCGACCTGGCCTACGCCCTGCCAGCCGACCGAGGGGTCCACGCGCAGGTGTGCGTGGGCGCCGTCCG
TCCGAGCACCCACTGGGAGGTCGCGGTGATGCCGCGATGA
 Primer design

Protein Sequence:479 a.a.
>NocF|ThioFinder134 Nocardia sp. ATCC 202099
MTGDLAEHTESLRRDPQGANPDGWRVDWADGPWPVKVYAGGVRTPLGRAGALDRLLLFTFGMTAVRFDPA
GGMPSTPDNPTPTHLGERYAPRRPIPSGGSMYPTEAYVVDTEAGRVSHYDPYRHELVDLGRPAPRAALRA
ALGEPADAPLPPAVLLVANRFWKNAYKYGEFAARLGAVDTGVALGRAARVAEAAFGDIAVLVDLDAAAVE
DLLGLDGRDEAVFAAVELGRRRDCPAEPPAERAAPPPVLERSRAVRRLPGLSALTEAARQPAEPVAVDRP
AAVRGPLDLLDPGVMVRRGSHGRRFTGAPVRLADVEAVLLHAAEAAARLAAVSGGAVGAEAGLCCAVRRV
EGLAPGWYRFDGALVPVAEDDPGPVLRRALFAESLNPELAAFTVHVTGPVDFAGGAAGYRARQLGVGAVV
EAVCLAATAARLSGHAVLGFDVGPIDLAYALPADRGVHAQVCVGAVRPSTHWEVAVMPR